KEGG   Klebsiella variicola DSM 15968: SP68_17160Help
Entry
SP68_17160        CDS       T03641                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kvq  Klebsiella variicola DSM 15968
Pathway
kvq00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kvq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SP68_17160
Enzymes [BR:kvq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SP68_17160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_35 Glyco_hydro_2_C Cellulase DUF4434 Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: AJE90905
LinkDB All DBs
Position
4992687..4994696
Genome map
AA seq 669 aa AA seqDB search
MSHLFYGVAYYDEYMPEDRLAKDIALMRETGINVVRIAESTWSTLEPEEGQYNFYHIDRV
LEAMHEAGIAVIVGTPTYAVPAWLAAKHPDILVTTVAGQQKYGPRQIMDIVNPTFRRYAE
KIIRTLMAHVQHHPAIIGWQLDNETKHYDNIGRYMQEGFVRSLQEKYPDLRQLNHDFGLD
YWSNRIDRWQDFPPVENTINASLACAFSRYQRQQVTEYLAWQAAIVREYAQPHQFVTHNF
DFEWRGYSYGVQPRVDHFAAAQALDIAGVDIYHPSQAHLTGREIAFGGAITRSLKPGQNY
FVLETQAQGFAQWTPFPGQLRLQAFSHIASGAAMVSYWHWHSIHNAFETYWKGLLSHDFS
RNPTWQEATTIGADFARLSPQLAELKAENDVALLISNEAMDALNHFRPGDAEGNIYNDIF
RRFHDALYDHNISLDIIHDVNEETSRYRVLLVPGLYAADDGLLTRINDYIARGGRALIGF
KSGFSDENVKVRNSAQPGILRQSCGVSYSQFTLPEGTTVSSCSAEIDCRNDNQAELWMEL
LTPDGGTRTLLRYQHPAWGEYAAATATDYGQGRALYVGFLPQKRLISQLFDVLTADLTLN
SRTSAYRYPLVVKKMRNRAGNTIHFLFNYSGEALDVVSETAGTALLSGEAVDVGQPLRLR
AWEFTIIES
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatttattttatggcgtggcgtattacgatgaatatatgccggaagatcggctg
gctaaggatatcgccttaatgcgcgaaaccggcattaacgtggtgcgtattgccgagtcc
acctggagtacgctggagcctgaagagggccagtacaatttctaccatatcgaccgggtg
ctggaggcgatgcatgaggccggcattgcggtcatcgtcgggacgccgacctatgcggta
ccggcctggctggcggcgaaacatcccgatattctggtcaccaccgtcgcggggcagcaa
aaatatggcccgcggcagatcatggatatcgtcaatccgacctttcgccgctatgccgaa
aaaattatccgcacgctgatggcccatgtgcagcaccatccggcgattatcggctggcaa
ctggataacgaaaccaagcattacgacaatattggccgctatatgcaggagggcttcgtg
cgcagcctgcaggagaaatatcctgacctccggcagctgaatcacgatttcggtctggat
tactggagcaaccgcattgaccgctggcaggattttccgccggtggaaaacaccatcaac
gccagcctcgcctgcgccttctcccgctatcagcgtcagcaggtcaccgagtatctggcc
tggcaggcggccatcgttcgggaatacgcccagccgcaccagttcgtcacccacaacttc
gatttcgaatggcgcggttactcttacggcgtgcagccgcgggtcgaccattttgcggcg
gcgcaggcgctggatatcgccggcgtcgatatctatcacccgagccaggcgcacctgacc
gggcgggaaatcgcctttggcggcgccatcacccgctcgcttaagccgggtcagaactac
ttcgtactggaaacccaggctcagggcttcgcccagtggacccccttcccgggccagcta
cgcctgcaggcattcagccatatcgcctccggcgccgccatggtctcctactggcactgg
cattcgattcataacgccttcgaaacctactggaaggggctgctcagccacgacttctcg
cgcaacccaacctggcaggaagccaccaccatcggcgccgatttcgcccgcctgtcgccg
cagctggcggagctgaaggccgaaaatgacgtcgcgttgctaataagcaatgaggcgatg
gacgccctcaatcacttccgtcccggcgatgccgagggcaacatttataacgatatcttc
cgccgcttccacgatgcgctgtatgaccacaatatcagcctcgacatcatccacgatgtg
aacgaggaaacctcgcgctaccgggtactgctcgttcctggtctgtacgccgccgatgat
ggcctgctaacacggattaacgactatatcgcccggggcggcagagcgctgatcggcttt
aaatcaggctttagcgatgaaaatgtcaaggtgcgcaacagcgcgcagccggggattttg
cgccagagctgcggcgtcagctacagccagttcaccctgccggaagggacgacggtaagc
tcatgcagcgcagagattgattgccgcaatgataatcaggctgagctgtggatggaattg
ctgacgcccgatggcggaacccgcacactgctgcgctatcagcatccggcatggggcgaa
tatgccgccgcaacggcgacggattacggtcagggacgcgccctgtacgttggcttcctg
ccgcagaagcgcctgattagccagctgtttgatgtcctgacggcggacctcacgctgaac
tcgcgaacttccgcctatcgctatccgttagtggttaaaaagatgcgtaaccgtgccgga
aatactatccacttcctgttcaattactccggcgaggcgctggatgttgtcagcgagacc
gcgggtaccgcgctgctgagcggggaggctgtagacgtcggccagccgttgcgcctcagg
gcctgggaatttactatcatcgaaagctaa

DBGET integrated database retrieval system