KEGG   Klebsiella variicola DSM 15968: SP68_23430Help
Entry
SP68_23430        CDS       T03641                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
kvq  Klebsiella variicola DSM 15968
Pathway
kvq00061  Fatty acid biosynthesis
kvq01100  Metabolic pathways
kvq01212  Fatty acid metabolism
Module
kvq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:kvq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SP68_23430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kvq01004]
    SP68_23430
Enzymes [BR:kvq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SP68_23430
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     SP68_23430
Lipid biosynthesis proteins [BR:kvq01004]
 Fatty acid synthase
  Component type
   SP68_23430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AJE92074
UniProt: A0A264C9U0
LinkDB All DBs
Position
3605110..3605628
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVIKMSETGGNYDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TAKKVTYRIHFKRIVNRRLIMGLADGEVLVDDRLIYTANDLKVGLFQDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagatcttcttgcctctggtcgtggtgaa
ctgttcggcgcgaaaggcccgcagttgccagcaccaaacatgctgatgatggaccgcgtc
atcaaaatgagcgaaaccggtggtaactatgacaaaggttatgttgaggcggaactcgac
atcaacccggacctgtggttcttcggttgccacttcatcggcgatccggtgatgccgggc
tgcctgggcctggatgcgatgtggcagctggtcgggttctatcttggctggctcggcggc
gaaggcaaaggccgtgcgctgggcgttggcgaagtgaaattcaccggtcaggttctgccg
accgcgaaaaaagtcacctaccgcatccacttcaagcgcattgttaaccgtcgtctgatt
atgggcctggcggatggcgaagtgctggttgacgatcgtctgatctataccgcgaacgat
ctgaaagtcggcctgttccaggatacttccgctttctga

DBGET integrated database retrieval system