KEGG   Ketogulonicigenium vulgare Y25: EIO_0115Help
Entry
EIO_0115          CDS       T01338                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu00020  Citrate cycle (TCA cycle)
kvu00310  Lysine degradation
kvu00380  Tryptophan metabolism
kvu01100  Metabolic pathways
kvu01110  Biosynthesis of secondary metabolites
kvu01120  Microbial metabolism in diverse environments
kvu01130  Biosynthesis of antibiotics
kvu01200  Carbon metabolism
Module
kvu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kvu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EIO_0115
  09105 Amino acid metabolism
   00310 Lysine degradation
    EIO_0115
   00380 Tryptophan metabolism
    EIO_0115
Enzymes [BR:kvu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     EIO_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N DMA
Motif
Other DBs
NCBI-ProteinID: ADO41305
UniProt: E3EX61
LinkDB All DBs
Position
complement(107626..110598)
Genome map
AA seq 990 aa AA seqDB search
MNDQSSSQAFRAADMLNGANADYIAHLQASYASDPQSVDESWRALFAALDDNGAAQAEVS
GPSWARRDWPPMAAGDAISALDGQWPGDPIPADQVKTTTQKLQAKAAEVGSKVSEGQLRT
AVLDSLRALMLIRAYRIRGHLAADLDPLGMQAKPYYPELDPASYGFTGADMERPIFIDNV
LGLEVATMTQIVDLVRRTYCGTFAMQYMHISDPAQSAWLKERIEGYGKEITFTREGRRAI
LNKLVEAEGFEKFLHVKYMGTKRFGLDGGEALIPAMEQIIKRGGAMGVQQIVMGMPHRGR
LSVLANVLSKPYRAIFNEFQGGSFKPEDVDGSGDVKYHLGASSDREFDGNKVHLSLTANP
SHLEAVNPVVLGKVRAKQAQLRDSERTKVLPILLHGDAAFAGQGVVAECFGLSGLVGHKT
GGTIHIVVNNQIGFTTAPSYSRSSPYPTDIALMVEAPIFHVNGDDPEAVVHAAKVATEFR
QLFHKDVVIDIFCYRRFGHNEGDEPMFTNPAMYKTIKGHKTTLTLYTDRLVADGLIPEGE
IEEMKARFQSHLNDEFEAAKTFKPNKADWLDGRWAHLGRPDQDNTPRVATAIAAETMAEI
GKSLTTAPDGFGLHKTVDRLLEAKRNMFETGEGFDWSTAEALAFGGLLTEGYPVRLSGQD
STRGTFSQRHSAFIDQQSETRYYPLNNIREGQSHYEVIDSMLSEYAVLGFEYGYSLAEPN
ALTLWEAQFGDFANGAQIMFDQFISSGESKWLRMSGLVMLLPHGFEGQGPEHSSARLERF
LQMCGGDNWIVANCTTPANYFHILRRQIHRDFRKPLVLMTPKSLLRHRLATSKASDFTEG
SSFHRVLWDDAQLGSSATELKPDDQIKRVVVCSGKVYYDLLEERDARGIDDIYLMRLEQF
YPFPTMTLVRELGRFKDAEMIWCQEEPRNQGGWSFVEPNFEWVLNRIEAKHRRLTYVGRA
ASASPATGLASQHKAQQNALVDEALTIKGN
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccagtcctcatcgcaagcctttcgcgccgcagatatgctgaacggtgccaat
gccgattacatcgcgcatttgcaggcaagctacgccagtgacccgcaatcggttgacgaa
agctggcgggctttgttcgccgcgcttgacgacaatggggcggcccaggccgaagtatct
ggcccctcttgggcgcggcgcgactggccgccgatggcggcgggcgatgcgatctcggcg
ctagacgggcaatggccgggcgatccgatccccgccgatcaggtgaaaaccacgacgcaa
aaactgcaggccaaagcggccgaggtcggcagcaaggtgtccgaaggccagctgcgcacc
gccgtgctggattcgctgcgcgcgctgatgctgatccgcgcctatcgcatccgtggccat
ttggccgccgaccttgatccccttgggatgcaggcaaaaccctattaccccgagctggac
ccggcctcttacgggttcaccggtgccgatatggaacgcccgatctttatcgacaacgtg
ctggggctggaagttgcgaccatgacccagatcgtcgatctggtccgccgcacctattgc
ggcacgtttgcgatgcaatacatgcacatctcggaccccgcacaatcagcttggctgaaa
gagcggatcgagggttacggcaaagaaatcaccttcacccgcgagggtcgccgcgcgatt
ctgaacaagctggtcgaggccgagggctttgaaaagttcctgcatgtcaaatacatgggc
accaagcgcttcggccttgatggcggcgaagcgctgatcccggcgatggagcagatcatc
aagcgcggcggcgcgatgggcgtgcagcagatcgtcatgggcatgccccaccgcggccgt
ctgtcggtgctggccaacgtgctgtccaaaccctatcgcgcgattttcaacgaattccag
ggcggcagctttaagcccgaggatgtcgatggttcgggcgatgtgaaatatcaccttggc
gcatcatctgatcgtgaattcgacggcaacaaggtgcacctgtcgctgaccgcgaacccc
tcgcacctcgaggcggtgaaccctgtcgtgctgggcaaagtgcgcgcgaaacaggcgcag
ctgcgcgatagcgagcgcaccaaagtgctgccgattctgctgcacggcgatgccgccttt
gccggtcagggcgttgtggcggaatgttttggcctgtcgggccttgttggccataaaacc
ggcggcacgatccatatcgtcgtgaacaaccagatcggctttaccaccgcgcccagctat
tcgcgatcctcgccctatccgaccgacatcgccctgatggtcgaggcgccgattttccac
gtcaacggcgacgatcccgaggccgtggtccacgccgccaaggtcgcgaccgagttccgc
caactgtttcacaaggacgtggtgatcgacattttctgctatcgccgctttggtcacaat
gagggcgacgagcccatgttcaccaacccggcgatgtataaaacgatcaagggccacaag
acgaccctgacgctttataccgaccgccttgtcgctgacggcctgatccccgaaggcgag
atcgaggagatgaaggcgcgtttccaaagccatctgaatgatgaattcgaggcggcaaag
accttcaagccgaacaaagccgactggctggacggccgctgggcgcatttgggccgcccc
gatcaggacaataccccgcgcgtcgccaccgcgatcgcggctgaaaccatggcggaaatc
ggcaaatcgctgaccaccgccccggatggctttggcctgcacaagaccgttgaccgcctg
ctggaagccaaacggaatatgtttgaaaccggcgaaggctttgactggtcgacagccgag
gctttggcctttggcggtctgctgaccgaaggctatcccgtccgcctgtcgggtcaggat
tcgacgcgcggcacgttcagccagcgtcattcggcctttatcgaccaacaaagcgagacg
cgttactatccgctgaacaatatccgcgaaggccagtcgcattacgaagtcatcgattcg
atgctgtcggaatatgctgttctgggctttgaatacggctattcgctggccgagccgaac
gccctgaccctgtgggaagcccagtttggcgatttcgcgaacggcgcacagatcatgttc
gaccagttcatctcgtcgggcgaatcgaaatggctgcggatgtcgggccttgtgatgctg
ctgccgcacgggttcgagggccaaggccccgaacactcgtccgcgcgccttgagcggttc
ttgcagatgtgcggcggcgataactggatcgtcgcgaactgcacgacgcctgcgaactac
ttccacattctgcgccgtcagatccaccgcgatttccgcaaaccgctggtgctgatgacg
cccaaatcgctgctgcgccaccgtttggcgacgtccaaggccagcgatttcaccgaaggc
agctcgttccaccgcgtgctgtgggatgatgcgcaactgggcagctcggcgaccgagttg
aagccggacgatcagatcaaacgtgtcgtcgtctgttcgggcaaggtctattatgacctg
ctcgaggaacgcgacgcccgcggcatcgacgatatctatctgatgcgtctggaacaattc
tatccgttcccgacgatgactctggtgcgcgagttgggccgcttcaaggatgccgagatg
atctggtgtcaagaagagccccgcaaccagggcggctggagctttgtcgagccgaatttc
gaatgggttctgaaccggatcgaggcaaaacaccgccgtctgacttatgtcggtcgcgca
gcctcggcctcgcccgcaacggggcttgcaagccagcataaagcccagcaaaacgccctt
gtcgacgaagcgctgaccatcaaaggaaactga

DBGET integrated database retrieval system