KEGG   Ketogulonicigenium vulgare Y25: EIO_1947Help
Entry
EIO_1947          CDS       T01338                                 

Definition
(GenBank) putative oligopeptide ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:kvu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EIO_1947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kvu02000]
    EIO_1947
Transporters [BR:kvu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    EIO_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_22 AAA_29 oligo_HPY Mg_chelatase RsgA_GTPase AAA_7 AAA_25 ABC_ATPase AAA_5 AIG1 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADO43062
UniProt: E3F0Y0
LinkDB All DBs
Position
complement(1899286..1900842)
Genome map
AA seq 518 aa AA seqDB search
MADILQITDLCVDFGAARAVDGLSLALARGQVTALVGESGSGKSMTAMAVLGLLPANAQV
TGTVAFEGAVIPAAAGLGQWRGRGISTVFQDPSAALDPVFSIGFQIAEVLRLRHPDQNAR
ARKKAVIALLAEVGIPDPARRMHDFAHQFSGGQQQRIMIAMALAGRPQLLIADEPTTALD
VTVQRDILELLQRLVRDRDMTLLLITHDMGVVAEMADRILVMKDGRLVEAGEAPAALRAP
QSAYTRHLLNAATAHRPSPAPVQALVVLAVRDLVLGYQRPFRAPHRIVRGVSFTIHRGET
LGLIGESGSGKSTTGRSLVGLAKVIAGAIEFEGMDLSALRGPSLRAARARIGFVFQSPSG
ALNPKLTIAQIIAEPLRAHLSLDRAEIDTRVAALIAQVELPASFATRHPHQLSGGQKQRV
AIARALALSPSLLIADEPTSALDVSIRGEILDLLQRIQQETGLACLFISHDLEVVRGMCH
RVAIMQDGAIVEANTNAAIFAAPQDPYTRRLLASRYGQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggctgatattctgcagatcaccgatctttgcgtcgactttggcgcggcccgcgccgtc
gatggcctgtcccttgcattggcgcgggggcaggtgacggccctcgtgggcgaatccggt
tcgggcaagtcgatgaccgcaatggcggtgctgggcctgctgcccgcgaatgcgcaagtg
accggcacagtcgcgttcgagggggcggtgatccctgccgccgctggcctgggacaatgg
cgcgggcgcggcatcagcacggtctttcaggacccttcggcagcccttgatccagtgttc
agcattggctttcaaattgccgaggttttgcgcctgcgccaccccgatcaaaacgccagg
gcccgcaaaaaagctgtcattgccctgctggccgaggtcggaatccccgatcccgcgcgg
cgcatgcatgactttgcgcatcagttttcgggcggccagcaacagcggatcatgattgcg
atggcccttgcaggccggccgcagctgctgatcgcggacgagccgacaaccgcgctggat
gtcaccgtgcagcgcgacattctggaactgctgcaacggctggtgcgcgatcgcgatatg
acgctgctgctgatcacgcatgacatgggcgtggtggcagagatggccgaccgcattctg
gtgatgaaggatggccggctggtcgaggccggggaggcgcccgcggcgctgcgggcacca
caatccgcctatacccggcacctgctgaacgccgcgacggcgcatcgcccgtcgcccgcg
cctgttcaggcgctggtcgtgctggccgtgcgcgatctggtgctgggctatcaacgcccg
tttcgcgcgccccataggattgtgcgcggcgtgtcttttaccatccatcgcggcgagacg
ctgggcctgatcggcgaaagcgggtcgggaaaatccaccaccggccgcagccttgtcggc
ctggccaaagtcatcgcgggtgctatcgagttcgagggcatggatctatcggcactgcgc
ggcccgtcgttgcgtgcggcgcgggcgcggatcggcttcgtgttccaaagcccctctggc
gcgctgaacccgaaattgaccatcgcccagatcatcgccgagccgctgcgggcgcatttg
tcgcttgaccgggccgaaatcgacacccgcgtcgcggcgctgatcgcgcaggtcgaattg
cccgcaagctttgcaacgcgtcacccgcatcaactgtcgggcggccagaagcagcgcgtt
gccatcgcccgggccttggcgctttcgcccagcctgctgattgcggatgagccgacctcg
gcgctggatgtgtcgatccggggggagattctggacttgctccagcgcattcagcaggaa
accggcctcgcctgcctgttcatcagccacgatctggaggtggtgcgcggcatgtgccac
cgcgttgcgatcatgcaagacggcgccattgtcgaggccaataccaacgccgcaatcttt
gccgcaccgcaagatccctatacgcgcaggctgcttgcaagccgatatgggcagtga

DBGET integrated database retrieval system