KEGG   Ketogulonicigenium vulgare Y25: EIO_2597Help
Entry
EIO_2597          CDS       T01338                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
kvu  Ketogulonicigenium vulgare Y25
Brite
KEGG Orthology (KO) [BR:kvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kvu03012]
    EIO_2597
   03029 Mitochondrial biogenesis [BR:kvu03029]
    EIO_2597
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kvu04147]
    EIO_2597
Translation factors [BR:kvu03012]
 Eukaryotic Type
  Elongation factors
   EIO_2597
 Prokaryotic Type
   EIO_2597
Mitochondrial biogenesis [BR:kvu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    EIO_2597
Exosome [BR:kvu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EIO_2597
  Exosomal proteins of breast cancer cells
   EIO_2597
  Exosomal proteins of colorectal cancer cells
   EIO_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ADO43675
UniProt: E3EZD4
LinkDB All DBs
Position
complement(2498953..2500128)
Genome map
AA seq 391 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGEFRAYDQIDGAPEERARGITIST
AHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGAILVCAASDGPMPQTREHILLGRQ
VGIPYMVCYMNKVDLVDDAELLELVEMEIRELFSSYEYPGDDIPIIQGSAHQALIGERKD
IGEDSVRALMAAVDTYIPTPARAVDQPFLMPIEDVFSISGRGTVVTGRVERGVINVGDEV
EIVGIRDTKKSTCTGVEMFRKLLDRGEAGDNVGILLRGIDREGVERGQVLVKPKSVTPHT
EFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVELPEGTEMVMPGDNLKFNVTL
IAPIAMEEKLRFAIREGGRTVGAGVVARIIK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcaaagtttgaacgtaacaaaccgcacgttaacattggcacgattggccac
gttgaccacggcaagacgacgctgaccgctgcgatcacgaagtatttcggtgaattccgc
gcatacgaccaaattgacggtgcgcccgaagagcgtgcacgcggcatcacgatctcgacc
gctcacgtggaatacgagaccgaagcgcgccactatgcgcacgttgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtc
tgtgctgcgtcggacggcccgatgccgcaaacgcgcgagcacatcctgctgggccgccaa
gtgggtattccctacatggtctgctacatgaacaaggttgaccttgttgacgacgcagag
ctgctcgagctggtcgaaatggaaatccgcgagctgttctcgtcgtacgagtaccccggc
gatgacattccgatcatccaaggttcggcgcaccaggcgctgatcggcgagcgcaaagac
atcggcgaggactcggtccgcgcgctgatggctgctgtcgacacgtatatcccgacgcct
gcacgtgctgttgaccagccgttcctgatgccgatcgaggacgttttctcgatctcgggt
cgtggtactgtggtgaccggccgcgtcgagcgcggtgtgatcaacgttggcgacgaagtt
gagatcgtcggcatccgcgacacgaagaagtcgacctgcacgggcgttgagatgttccgc
aagctgctggaccgcggcgaagctggtgacaacgttggtatcctgctgcgcggtatcgac
cgcgaaggcgttgagcgtggccaggttctggtcaagcccaagtcggttaccccgcacacc
gagttcgaagccgaggcgtatatcctgaccaaggaagaaggcggccgtcacacgccgttc
tttgcgaactaccgtccgcaattctacttccgcacgaccgatgtgaccggcactgttgag
ctgcccgagggcaccgagatggtgatgccgggcgacaacctgaagttcaacgtcacgctg
atcgcgccgatcgccatggaagagaagctgcgcttcgctatccgtgaaggcggccgcacc
gtcggtgcaggcgtcgtcgcacgcatcatcaagtaa

DBGET integrated database retrieval system