KEGG   Ketogulonicigenium vulgare Y25: EIO_3151Help
Entry
EIO_3151          CDS       T01338                                 

Gene name
suhB
Definition
(GenBank) extragenic suppressor protein SuhB
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
kvu  Ketogulonicigenium vulgare Y25
Pathway
kvu00521  Streptomycin biosynthesis
kvu00562  Inositol phosphate metabolism
kvu01100  Metabolic pathways
kvu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    EIO_3151 (suhB)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EIO_3151 (suhB)
Enzymes [BR:kvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     EIO_3151 (suhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: ADO44209
UniProt: E3F5G5
LinkDB All DBs
Position
pYP12:19840..20643
Genome map
AA seq 267 aa AA seqDB search
MMTDPFIPSARLAQLIAAAHAGGAIARAALRRRDASEVVHKAVRDYQTEADVAVERAIVA
HLAPHFPDHAIAGEEGADDRAGSAGRIVIDPIDGTTNFMWGMPHFGVVITLVEGGETVAG
VTYDPMMDETFAAERGAGAYLNGQRLQLSHSLDAINAVFGAGLPIPGQVKSVTEARYHAA
LRRLMDTSAGVRRLGSSALSIAWVAAGRLDGFFEDGLSLHDYGASVLILREAGGIVTDFA
GGDIKNPGAILAGRPGLHDWLLEGFKA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagatccttttatcccctccgcccgccttgcccaactgattgccgccgctcat
gcgggcggcgccatcgcccgcgccgcactgcgccgccgcgacgcctccgaggttgtccac
aaagccgtccgcgattaccagaccgaggcggatgtcgcggtcgaacgtgccattgtcgcc
catctggcgccccatttccccgatcacgccatcgcgggcgaagagggcgccgatgaccgc
gcgggttccgctggccgcatcgtcatcgacccgatcgacggcaccaccaatttcatgtgg
ggcatgccgcattttggcgtcgtgatcacgctggtcgaaggcggcgagaccgtcgcgggc
gtcacctatgacccgatgatggacgagacctttgccgcagaacgtggcgcgggggcctat
ctcaacggccagcgcctgcaactcagccacagccttgacgcgatcaatgccgtctttggc
gcgggcctgccgatccccggtcaggtgaaatccgtgaccgaggcacgctatcatgccgcc
ctgcgccgcctgatggatacatctgcgggcgtgcgccgccttggctcctcggcgctgtcg
attgcttgggttgcggcgggccggctcgacgggtttttcgaagatggcctgtcgctgcat
gattacggcgcatcggtgctgatcctgcgcgaagcgggcggcatcgtcaccgactttgcc
ggcggcgacatcaaaaaccccggcgcgatccttgcgggtcggccggggctgcatgattgg
ctgctggagggctttaaagcctaa

DBGET integrated database retrieval system