KEGG   Kyrpidia spormannii: CVV65_08015Help
Entry
CVV65_08015       CDS       T05215                                 

Definition
(GenBank) DNA polymerase domain-containing protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
kyr  Kyrpidia spormannii
Pathway
kyr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:kyr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CVV65_08015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:kyr03400]
    CVV65_08015
Enzymes [BR:kyr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CVV65_08015
DNA repair and recombination proteins [BR:kyr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CVV65_08015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ATY84874
UniProt: A0A2K8N6A7
LinkDB All DBs
Position
1565448..1566362
Genome map
AA seq 304 aa AA seqDB search
MCTDVEKVWWTGVKTVLPQNLGKVLWPGVFTKGDLLEYLATVGTVMIPHLKDRPVTVIRY
PDGIEEEGFFQKHPPPGTPDWVTRVTIGEGEAIVIDRLETLLWLGQLGAIEYHVTFSRFP
AVDRPTYLVFDLDPSVEGFAAVCRVALMIRDVLTRLGLPSYPKTSGATGIQVYVPIHGSV
TFEQTRPLMRTIAKYCEHRAPELITTERRVRARGNRVYIDYLQHAPNKTLIAPYSPRAVP
TAAVSAPLQWEEVERGMAPENWTIATMAKRLQKMGDLFAPVLDPGVDIRPLLQHLDELSS
KRSP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atctgtacagatgttgagaaggtgtggtggacgggcgtgaaaacggttctgcctcaaaac
ctgggcaaggttctgtggcccggtgtgttcaccaaaggggaccttctcgaatatttggcg
accgtgggaactgttatgatcccgcacctcaaggatcggccggtcacggtcattcgctac
ccggatggaattgaagaagaaggtttttttcagaaacatcctccccccggaacaccggac
tgggtgacgcgggtaacgataggggaaggggaggccatcgttatcgaccgcctggaaacg
ttgctatggctggggcagctcggtgcgatcgaataccacgtgacctttagccggttcccc
gccgtagaccggccgacttatttggtgtttgatttggacccgagtgtggaaggatttgcc
gccgtctgccgggtggccttgatgatccgggatgttctaacccggctcgggctcccatcg
taccccaagacctccggagccacgggaattcaagtatacgttcccatccacgggtccgtc
acttttgagcagacacggccactgatgagaaccattgccaagtactgcgaacaccgggcc
ccagagttgatcacgacagaacgtcgggtgcgagcacgggggaatcgagtgtatatcgac
tatcttcaacacgcgccgaacaagacattgatcgctccgtattccccccgggccgtaccg
actgcggcagtttctgcccctcttcagtgggaagaggtagaacgagggatggcacccgaa
aactggacaatcgcgaccatggccaaacggctacaaaaaatgggagatttattcgccccg
gttctcgatcctggagtggatattcggccgttgctccaacatttagacgagttatcatca
aaaagaagtccttga

DBGET integrated database retrieval system