KEGG   Kyrpidia spormannii: CVV65_11320
Entry
CVV65_11320       CDS       T05215                                 

Definition
(GenBank) 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
kyr  Kyrpidia spormannii
Pathway
kyr00362  Benzoate degradation
kyr00622  Xylene degradation
kyr00643  Styrene degradation
kyr01100  Metabolic pathways
kyr01120  Microbial metabolism in diverse environments
kyr01220  Degradation of aromatic compounds
Module
kyr_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:kyr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CVV65_11320
   00622 Xylene degradation
    CVV65_11320
   00643 Styrene degradation
    CVV65_11320
Enzymes [BR:kyr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     CVV65_11320
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Esterase FSH1 Abhydrolase_5 UPF0227 Peptidase_S15 Thioesterase Ndr
Other DBs
NCBI-ProteinID: ATY85443
UniProt: A0A2K8N823
LinkDB
Position
complement(2251777..2252634)
AA seq 285 aa
MSEDHGSVQVGQYVDAGGIRTHYHVLGEGPNVLLIHGSGPGVSAWANWGGVLPRLAARFR
VYALDVVGFGKTERPTAIEYRLETWVNHVKNFMDAVGAVPAMIVGNSMGGAVALRLTAQH
PEYVRALVLMGAVGVPFRITEGLDAVWGYRARGVEEMERIMDIFAFDKSLLTPDLARLRY
EASLEPESRSAYEEMFPEPRQRHVDAMVTPEEDIRNIVRPTLVIHGREDQVIPVDNSYRL
FNLLPYAQLHIFGRCGHWTQIERRDEFCELVEMFFGRVSRGKAGA
NT seq 858 nt   +upstreamnt  +downstreamnt
atgtctgaagatcatgggtccgtacaagtcggacagtacgtcgatgccggaggaatacgc
acgcattaccacgttcttggagaagggccgaatgttcttttgatccacgggtccggtccc
ggagtatcggcgtgggccaattggggaggggttcttccccggttggccgcccggtttagg
gtgtacgcactcgatgtcgtgggctttggcaaaacggagcgtcccaccgcaatcgaatac
cgactcgaaacctgggtgaatcatgtaaagaatttcatggatgccgtcggggctgtcccg
gccatgatagtcggcaactccatgggtggggcggtggcccttcggctgacggcccagcat
ccggaatatgtgcgtgccttggtgttgatgggagcggttggggtgccgttcagaattacg
gaaggactggatgcggtttggggataccgagcccgtggcgtggaggaaatggaacgcatt
atggatatctttgcgttcgataaatcccttctgactccggacctggcgaggcttcgttac
gaagccagtctggagcccgaatcccggtccgcctatgaagaaatgtttccggagccccgg
cagcgacacgtggatgcgatggtgacacccgaagaggatatccggaatattgtccgcccg
actctggtcattcacgggcgtgaagatcaagtgattccggtggacaactcgtatcggttg
tttaatctgcttccctatgcccagctccacattttcggacgttgtggtcactggacacag
attgagcgccgagatgagttctgtgaattggtagaaatgttttttggacgggtgtcccga
gggaaagcgggggcgtga

DBGET integrated database retrieval system