KEGG   Kyrpidia sp. EA-1: CVV65_12110Help
Entry
CVV65_12110       CDS       T05215                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kyr  Kyrpidia sp. EA-1
Pathway
kyr00020  Citrate cycle (TCA cycle)
kyr00480  Glutathione metabolism
kyr01100  Metabolic pathways
kyr01110  Biosynthesis of secondary metabolites
kyr01120  Microbial metabolism in diverse environments
kyr01130  Biosynthesis of antibiotics
kyr01200  Carbon metabolism
kyr01210  2-Oxocarboxylic acid metabolism
kyr01230  Biosynthesis of amino acids
Module
kyr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kyr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CVV65_12110
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CVV65_12110
Enzymes [BR:kyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CVV65_12110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ATY85578
UniProt: A0A2K8N8B9
LinkDB All DBs
Position
complement(2410291..2411589)
Genome map
AA seq 432 aa AA seqDB search
MAKFEKLTPPGEGERIVVREGSLSVPDRPIIPFIEGDGTGPDIWRASQRVFDAAVDKAYG
GKRKIVWFEVYAGEKAYHTFGEWLPPDTLTAFREYIVGIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCQRPVRYFDGVPSPVKRPELVDMVIFRENSEDIYAGIEWEEGTPEVRTVIEFLQ
NQMGVKKIRFPETSGIGIKPVSRQGTERLVRAAIDYALKNGRRSVTLVHKGNIMKFTEGA
FKNWGYELAEREYGDRVFTWAQYDRIKAQSGVEEASRVQAEAEAAGKLVVKDVIADAFLQ
QILTRPAEYDVIATLNLNGDYISDALAAQVGGIGIAPGANINYETGHAVFEATHGTAPKY
AGLDKVNPGSVILSGVMMLEYMGWKEAAALIVKAMEKTIRERVVTYDFARLMTGAKEVKT
SEFATALIGNME
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtttgaaaagctgacaccgcccggcgaaggtgagcggatcgtcgtgcgggag
gggtcattgtctgttcccgaccgcccgatcatcccctttattgagggcgatgggacaggg
ccggacatttggagggcctcccagcgcgtgttcgacgcggcggtggacaaggcctacgga
ggcaagcggaagatcgtttggtttgaagtgtacgccggtgaaaaggcctatcacactttc
ggggagtggctccccccggacaccttgaccgcctttcgcgaatacatcgtggggatcaaa
gggcctctgacaacacccgtgggcggtgggattcgctcattgaatgtcgccctccggcag
gagttggacttatatgtgtgccagcggccggttcggtattttgatggcgtcccctctccg
gtgaagcgcccagagttggtggacatggtcattttccgggaaaattccgaggatatttac
gcggggatcgaatgggaggaagggactccggaggtccgcacggtcatcgagtttctgcag
aatcagatgggcgtgaaaaagattcgattccccgagacctcgggcatcggcatcaagccg
gtatccaggcagggaactgagcggctggtgcgggcagccatcgactacgccctgaaaaat
ggccgtcggagcgtgacgttagtccacaagggaaatattatgaaattcaccgaaggcgct
tttaagaattggggctacgagttggccgagcgggagtacggggatcgggtgtttacctgg
gcgcagtatgaccggatcaaggcccagagcggcgtggaagaggcgagccgggttcaggcc
gaagcggaagcggccggcaagttggtggttaaggacgtgattgccgacgctttcctgcag
cagattctgactcggcctgcggagtacgacgtgatcgccaccttgaatctcaacggggat
tacatttctgacgctttggcggcccaggtcgggggcatcggcatcgccccgggggccaac
attaactacgaaaccggacacgctgtatttgaggcgacccatggcacggcgccgaaatat
gccggtctggacaaggtcaaccccggatcggtgatcctctccggcgtcatgatgttggag
tatatgggctggaaggaagcggccgcccttatcgtcaaggccatggagaagaccattcgg
gaacgggtggtcacctatgatttcgcccggttgatgaccggggcgaaagaggtcaaaacc
tcggagttcgccaccgccctgattggcaatatggaataa

DBGET integrated database retrieval system