KEGG   Kurthia zopfii: NCTC404_01481Help
Entry
NCTC404_01481     CDS       T05934                                 

Gene name
hisE
Definition
(GenBank) Phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
kzo  Kurthia zopfii
Pathway
kzo00340  Histidine metabolism
kzo01100  Metabolic pathways
kzo01110  Biosynthesis of secondary metabolites
kzo01230  Biosynthesis of amino acids
Module
kzo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:kzo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NCTC404_01481 (hisE)
Enzymes [BR:kzo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     NCTC404_01481 (hisE)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     NCTC404_01481 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: VEI06031
UniProt: A0A2U3AGV4
LinkDB All DBs
Position
1:1447148..1447759
Genome map
AA seq 203 aa AA seqDB search
MTMKFDAQGLIPAIVQHAQTKEVLTLAYMNEQSYTKTMETGETWFYSRSRQELWHKGATS
GHTQKVVAMRLDCDGDALVVEVLPNGPACHTGEESCFHEIVKEKDSAIGSLDILSTLKEV
IANREVDMPEGAYTTYLFTEGIDKIGKKVGEEATEVVIAAKNCDAEELKWEAADLMYHLL
VLLQEQKLDLYEVLSVLQKRHEK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaaatttgatgctcaaggattaatcccagcaattgttcaacatgcgcaaacg
aaggaagtactgacgcttgcctatatgaatgaacaatcttatacgaaaacaatggagacg
ggcgaaacatggttttattctcgttcacgccaagagctatggcataaaggagcgacgagc
ggtcatacgcaaaaggttgtagcgatgcgtttggactgtgatggcgatgcactcgttgtc
gaagttttaccgaatgggccagcttgtcatacaggcgaagaaagttgcttccatgaaatc
gtcaaagagaaggattcggcaataggttcacttgatattttatcgacactaaaagaagtc
attgcgaatcgtgaagtcgacatgccagaaggtgcttatacgacgtacttattcacggaa
ggtatcgacaagatcggcaagaaagtcggggaagaagcgacggaagtagtcatcgctgca
aaaaactgcgatgctgaagaattgaagtgggaagcagccgatttaatgtaccatttactc
gtgcttttacaagagcaaaagcttgatttatatgaagttcttagcgtgctacaaaaacgt
cacgaaaaatag

DBGET integrated database retrieval system