KEGG   Kurthia zopfii: NCTC404_01757Help
Entry
NCTC404_01757     CDS       T05934                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kzo  Kurthia zopfii
Brite
KEGG Orthology (KO) [BR:kzo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC404_01757 (ahpF)
Enzymes [BR:kzo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC404_01757 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 FAD_binding_3 FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C K_oxygenase NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: VEI06316
UniProt: A0A448P7W5
LinkDB All DBs
Position
1:1716362..1717939
Genome map
AA seq 525 aa AA seqDB search
MRELRFAAENMLLDDQIKAQLKQYLAMLENNLVLKVSVGEDEVSKNMMELVQTLDDMSDK
ITVEKASLKRTPSFSVNPVGSDSGIEFAGLPLGHEFTSLVLALLQVGGRAPKVDETTIKR
IQAIKEPMHFETYVSLTCHNCPDVVQALNIMAVLNPNISHTMIEGGAYQAEVKEREILAV
PAIYRGDDFFEGGRITLDEILDKVGSTVDAAEFDSKEPFDVLVVGGGPAGASAAIYSARK
GIRTGIVADRFGGQVNDTLSIENIIGTKATEGPKFVASLEAHVADYEIDVMKSQRAARIE
KKDLIEVELENGAVLKSKTVILSTGARYRQLGVKGEAEFKNKGVAYCPHCDGPLFKGKDV
AVVGGGNSGVEAAIDLAGIVNHVTVLQAMDELRADQVLQDRLRSLPNVTVITDALTSEVT
GDSTVNGLSYVDRVSGEEKHIELDGVFVQIGLLPNTEFLKDSVELNKHGEIIVDRNGKTN
IPGVFAAGDCTDSAHKQIIISMGAGATASLSAFDHIIRSVELVEA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagaattacgatttgcagcagaaaatatgttattagatgatcaaattaaagcgcaa
ttaaaacaatatttagcaatgcttgaaaataatcttgtcctaaaagtgagtgttggagaa
gatgaagtttcaaaaaatatgatggaacttgtacaaactttagatgatatgtcagataaa
atcacagttgaaaaagcgtcattaaaacgtacgccaagtttctctgtaaacccagttgga
tctgattcaggtattgaattcgcaggtcttccacttggtcacgaattcacttcattagta
cttgcgttactacaagttggtggacgtgcgccaaaagttgatgaaacaactatcaaacgc
atccaagcaatcaaagagccaatgcactttgaaacatatgtatcattaacttgtcataac
tgtccagatgttgtacaagctttaaatattatggctgttctaaacccaaatatttcacat
acaatgatcgaaggtggcgcttatcaagctgaggtcaaagaacgtgaaattctagctgtt
cctgcaatttaccgcggagatgatttcttcgaaggtggtcgtattactttagacgaaatt
ttagataaagttggttcaacagttgatgcagctgaattcgatagtaaagaaccatttgat
gtattagttgtcggtggaggtcctgcaggtgcaagtgctgcaatctactcagctcgtaaa
gggattcgcacaggaatcgtagcagatcgtttcggcggccaagtaaatgatacactttca
atcgaaaatatcattggtactaaagcgactgaaggtcctaaatttgtcgcaagtctagaa
gcacatgttgctgactacgagattgatgttatgaaatctcaacgtgctgcacgtatcgag
aaaaaagatttaatcgaagtagaattagaaaacggtgctgttctaaaaagtaaaacagtt
attctttcaacaggtgctcgctaccgtcaattaggcgttaaaggcgaagcagaattcaaa
aacaaaggtgttgcatattgcccacactgtgatggtcctttattcaaagggaaagatgtt
gcagtagtaggtggcggtaactcaggtgttgaagctgcaatcgacttagctggtatcgta
aatcacgtaacggtattacaagcaatggatgagctaagagccgatcaagtactacaagat
cgcctacgcagtttaccaaacgtaacggttattacagatgcattaacttctgaagtaaca
ggtgattcaactgtaaatggtctttcatatgttgatcgtgtatctggtgaggaaaaacat
atcgaattagatggcgtattcgttcaaatcggtttacttccaaatacagagttccttaaa
gattcagtggaattaaacaaacatggtgaaattatcgttgaccgtaatggtaaaacgaat
atcccaggcgtatttgctgcaggtgactgtacagattcggctcataaacaaatcattatt
tcaatgggtgcaggtgcaacagcttcattaagtgcttttgaccacattattcgctcagtt
gaattagtagaagcataa

DBGET integrated database retrieval system