KEGG   Kurthia zopfii: NCTC404_02843Help
Entry
NCTC404_02843     CDS       T05934                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kzo  Kurthia zopfii
Pathway
kzo00010  Glycolysis / Gluconeogenesis
kzo00030  Pentose phosphate pathway
kzo00051  Fructose and mannose metabolism
kzo00052  Galactose metabolism
kzo00680  Methane metabolism
kzo01100  Metabolic pathways
kzo01110  Biosynthesis of secondary metabolites
kzo01120  Microbial metabolism in diverse environments
kzo01130  Biosynthesis of antibiotics
kzo01200  Carbon metabolism
kzo01230  Biosynthesis of amino acids
kzo03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:kzo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCTC404_02843 (pfkA)
   00030 Pentose phosphate pathway
    NCTC404_02843 (pfkA)
   00051 Fructose and mannose metabolism
    NCTC404_02843 (pfkA)
   00052 Galactose metabolism
    NCTC404_02843 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    NCTC404_02843 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    NCTC404_02843 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:kzo01009]
    NCTC404_02843 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:kzo03019]
    NCTC404_02843 (pfkA)
Enzymes [BR:kzo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NCTC404_02843 (pfkA)
Protein phosphatases and associated proteins [BR:kzo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NCTC404_02843 (pfkA)
Messenger RNA biogenesis [BR:kzo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NCTC404_02843 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 CobA_CobO_BtuR DAGK_cat
Motif
Other DBs
NCBI-ProteinID: VEI08362
UniProt: A0A2U3AEW2
LinkDB All DBs
Position
1:complement(2793059..2794018)
Genome map
AA seq 319 aa AA seqDB search
MKKIGVLTSGGDSPGMNAAIRAVVRKAIYHDLQVAGIYHGYQGLIEGNIQDLAIGDVGDI
IQRGGTKLYSARCLDFKEEAGQLKGIEQLKKHGIEGLVVIGGDGSYRGALALSNHGFPCV
GVPGTIDNDISGTDYTIGFDTALNTVIDSIDKIRDTATSHDRSFIIEVMGRDAGDLALWA
GLAGGAETILVPEDPFDIDDIAMRLKRGRDRGKKHSIIVVAEGVMTGHELQQKLMEKADI
PTHVSVLGHIQRGGSPTARDRVLASQMGAKAVELLLQDIGGKAVGIRNREILAYDFNEVF
DGTHEFDESMYKLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggcgtattaacaagtggtggagattcaccaggtatgaatgcagcgatt
cgtgctgttgttcgtaaagcaatttatcatgatttacaagtcgcaggtatttatcatggt
taccaaggtctaatcgaaggcaatatacaagatttagcaattggtgatgttggtgatatt
attcaacgaggcggaacaaaactttactctgcacgttgtttggattttaaagaagaagct
ggtcagttaaaaggaattgaacagttgaaaaagcatggaattgaaggattagttgtcatc
ggtggagatggttcatatagaggagcactcgcattgagcaaccacggattcccttgtgta
ggtgttcctgggacaattgataatgatatttcaggcacggattatacaattggtttcgat
acagcattgaatactgttattgactctattgataaaattcgagatactgctacttcacat
gatcgctcgtttattatcgaggttatgggaagagatgctggtgacttagcactttgggct
ggtcttgctggcggagcagaaacaattttagtgccggaagatcctttcgacattgacgat
attgcgatgcgtttaaaacgcggacgcgatcgtggtaaaaaacatagtattatagttgtc
gcagaaggtgttatgacaggacatgaattacagcaaaagctaatggaaaaggcagatatt
ccaacccatgtttctgtacttggacatattcaaagaggtggttcaccgactgcccgtgac
cgagtactcgcttcacaaatgggggcgaaagctgtagagttactgttacaagatattggc
ggcaaggctgttggtattcgcaatcgtgaaatacttgcttacgattttaacgaagtgttt
gatggtacgcatgagtttgacgagagtatgtataaattatctaaagaactatcgatttaa

DBGET integrated database retrieval system