KEGG   Candidatus Liberibacter asiaticus gxpsy: WSI_04225Help
Entry
WSI_04225         CDS       T02506                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
laa  Candidatus Liberibacter asiaticus gxpsy
Pathway
laa00970  Aminoacyl-tRNA biosynthesis
laa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WSI_04225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:laa03029]
    WSI_04225
Enzymes [BR:laa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     WSI_04225
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     WSI_04225
Mitochondrial biogenesis [BR:laa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    WSI_04225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AGH17215
LinkDB All DBs
Position
960535..962037
Genome map
AA seq 500 aa AA seqDB search
MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD
AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG
EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT
KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV
NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD
LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR
DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE
KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG
GKANPSIVQKMLKEKLGIKE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtctcacttgatacacatgtcgctcgttcagaatctctcacatctggtacaacaggc
gactgggaagttgtcatagggattgaggtgcatgcacaattatctgttgtctcaaagtta
ttttcaggtgcatcggttaattttggtgcggaacctaatacgcaagttagtttttttgat
gcagcaatgccaggaatgttaccaatattgaatggacgttgtgttcaacaagccgttatg
acaggtcttggattaaatgctcatattaataaatactctgtattcgctaggaaaaattat
ttctatccagatcttccccaaggatatcagatttcgcagcatgataagcctattgtagga
gaggggaaggtttctgtttctattggtccagataaatcaggtcaatttagaacaatagaa
gtaggaattgagcgtattcacttagaacaagatgctggcaagtccattcatgatcagtat
tcggcggtttcttgtattgatctcaatcgttctggtgtagcattgatggaaatagtgact
aagccagatatgcgttcttcgcttgaagcaaaagcttttttgactaaattacgtagtata
ttgcgttatttaggaacttgtgatggaaatatggaagaaggttcaatgcgcgcggatgtc
aatgtttcagtttgtcgccctggggaggcatggggtacgcgttgtgaagttaaaaatgtg
aattctattcgttttttaggacttgccattgaatatgaggcacgtcgtcaaattgctatt
cttgaggatggagggcatattagacaagaaacgcgcttgtttgatccttcaaaaaacgaa
acacgttctttgcgtactaaagaagatgctcttgattaccgttatttctctgaaccggat
ttacttcctttggagattgatgaagattttatacgcgcaattaaaaaacagattcctgaa
cttcctgatgccaagagagaacgttttattggtgaatttggtatttctctttatgatgct
tctgttttagtttctgacaaatcaatcgcggattattttgaaaaattagcagtaaatcgt
gataaaaagatcgttgctaattgggttattaatgatcttttgggcgtactgaataggtca
gggaaaagtatagaagatacacctatttctccgaatcaattaggagaattaattgactta
attatcgatggaacaatatcgggaaagattgcaaaggatattttcaatatattgtgggaa
aaaggaggaaccccaaaggaaatcgtagaggagctagggttacgtcaagtaacagatctc
tcagctattgaaaaggttgttgatgaagttattaattctaatcccaataatgtagcacga
atagcaacaaaacccaatttagtaagctggtttgttgggcaagtcatgaaaaataccggt
ggaaaagctaatcctagcattgtgcaaaaaatgttgaaagaaaaattagggataaaagag
tag

DBGET integrated database retrieval system