KEGG   Lysobacter antibioticus 76: LA76x_1176Help
Entry
LA76x_1176        CDS       T04154                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lab  Lysobacter antibioticus 76
Pathway
lab00473  D-Alanine metabolism
lab00550  Peptidoglycan biosynthesis
lab01100  Metabolic pathways
lab01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LA76x_1176 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LA76x_1176 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LA76x_1176 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lab01011]
    LA76x_1176 (ddl)
Enzymes [BR:lab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LA76x_1176 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lab01011]
 Precursor biosynthesis
  Amino acid ligase
   LA76x_1176 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ALN79335
UniProt: A0A0S2F6Z3
LinkDB All DBs
Position
1353416..1354408
Genome map
AA seq 330 aa AA seqDB search
MSPQFAPLRVTDPAVFGRVAVLMGGTSAEREVSLDSGRGVLEALRSRGVDAFAIDGIPAL
MDTIRSGGVDRVFNILHGNKGGGEDGVLQGVLEALGVPYTGSDVLGSALAMDKIRTKQVW
MSTGLPTPRYKRIAKGDDVHAAAREIGLPVIIKPSSEGSSVGVSRVLKDADIDEAVALAA
RYPGEMLMEQMVIGDELTVAVLVNGEGYSALPSIRIVPKGEWYDYHAKYIADDTQYLCPG
LDGADEDEIRRLAMEAFVAAGCKGWGRVDVMRDRSSGQLYLIEVNTAPGMTSHSLVPKAA
RQVGIEYDELCWRVLEATVVAPPAVGGDAA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccgcagttcgcgccgttgcgcgtcaccgacccggccgtgttcggccgcgtcgcc
gtgctcatgggcggcaccagcgccgagcgcgaagtgtcgctggattccgggcgcggcgtg
ctggaagcgctgcgttcgcgcggggtcgacgcgttcgcgatcgacggcatcccggcgctg
atggacaccatccgcagcggcggcgtcgatcgcgtcttcaacatcctgcacggcaacaag
ggcggcggcgaagacggcgtgctgcagggcgtgctggaagccttgggcgtgccgtatacc
ggttcggacgtgctcggctcggcgctggcgatggacaagatccgcaccaagcaggtgtgg
atgtcgaccggcctgccgaccccgcgctacaagcgcatcgccaagggcgacgacgtccac
gcggcggcgcgcgagatcggcctgccggtgatcatcaagccgtccagcgaaggctccagc
gtcggcgtgtcacgggtgctcaaggacgccgacatcgacgaggcggtggccttggccgcg
cgctatccgggcgagatgctgatggagcagatggtgatcggcgacgagctgaccgtggcc
gtgctggtcaacggcgagggctacagcgcgctgccgtcgatccgcatcgtgcccaagggc
gagtggtacgactaccacgccaagtacatcgccgacgacacccagtacctgtgcccgggc
ctggacggcgccgacgaagacgagattcgccggttggcgatggaagccttcgtcgccgcg
ggttgcaagggctggggccgggtcgacgtgatgcgcgaccgcagcagcggccagctgtat
ctgatcgaggtcaacaccgcgccgggcatgaccagccactcgctggtgccgaaggccgcg
cgccaggtcggcatcgagtacgacgagctgtgttggcgcgtgctcgaggcgaccgtggtc
gcgccgcccgccgtaggaggtgacgcggcgtga

DBGET integrated database retrieval system