KEGG   Lysobacter antibioticus 76: LA76x_4157Help
Entry
LA76x_4157        CDS       T04154                                 

Gene name
mrcA
Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
lab  Lysobacter antibioticus 76
Pathway
lab00550  Peptidoglycan biosynthesis
lab01100  Metabolic pathways
lab01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LA76x_4157 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LA76x_4157 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lab01003]
    LA76x_4157 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lab01011]
    LA76x_4157 (mrcA)
Enzymes [BR:lab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     LA76x_4157 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LA76x_4157 (mrcA)
Glycosyltransferases [BR:lab01003]
 Polysaccharide
  Bacterial polysaccharide
   LA76x_4157 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:lab01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   LA76x_4157 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ALN82273
UniProt: A0A0S2FFI0
LinkDB All DBs
Position
4749879..4752467
Genome map
AA seq 862 aa AA seqDB search
MSRIRRWLRWALYAFIGAVLLGAIALGTLYYLIVPKLPDVETLRTVELQEPMYVYARDGR
LMALFGETRRYPIAIEDVPDRLKQAFIAIEDARFYKHHGIDYKGIGRAIWLLATTDDKRV
PGGSTITQQVARQFFLSSEYSYKRKLGEMLLAMRMERELSKDEIFELYLNKSFFGNRAYG
VGAAAEFYYGKKMSELSLDEMASLAGIPKFPSSGNPLSNPDRAKLRRDYILDRMAEQRFI
SADEAAQAKAVPMHASPHERPVEVYAPYVAEMVRQEMIARYGAEALTKGYHVTTTIDPTL
QVAADKAVRDGLSVYDRRHGWHGVEQHFDLAAGEDAATARQRLRGIPAQANLLPAVVLGS
SGGQANVVLGDGTELTLTEKQGFGGRSPGSLVKRGDVVRIQRTETVTEPVVAPAAPAGTA
AAAAVVPAVPAKPPVVSYRLDQLPQAQAALVSLEPSNGALRALSGGYSFAGAKFNRATQA
RRQPGSSFKPFVYAAAFERGYNPASIVLDAPVVFKDRRGHLWRPQNDGGNFAGPMRVREA
MVQSRNLVSVRLLDAMGVDFARKYISHFGFDPEQLPPNLSMSLGTASLTPLSVARGYSVF
ANGGFRITPWFIDEVKDRAGAVVFKEKPATACPECGGRGGTSVAVPVSTVVDGFDLGPAG
GSADTAKPDPNKPDPKAKKAEDKPAAPKKELTAAEKASMNLAPRAIDDRIAYQIVSMLRD
VVKRGTGTAAKVLGREDVGGKTGSTNDHRDAWFSGFGGPYVTTVWVGRDNYKSLGYREYG
GKAALPIWIDYMRVALKDQPLAVNEPPQGMVKVSVAGNGALIPDGAGGVIEWVKAEDLER
MQTYTDYGNEESAPSEESYDIF
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtattcgccgttggctgcgttgggcgctctatgcgttcatcggcgcagtcctg
ctgggcgccatcgcgctcggcaccctgtactacctgatcgtccccaagcttcccgacgtc
gagaccctgcgcacggtcgagctgcaggaaccgatgtacgtctatgcccgcgacggccgc
ctgatggcgctgttcggcgagacccggcgctacccgatcgccatcgaggacgtgcccgac
cggctcaagcaggcgttcatcgcgatcgaggacgcccgtttctacaagcaccacggcatc
gactacaagggcatcggccgggcgatctggctgctggcgaccaccgacgacaagcgcgtc
ccgggcggctcgaccatcacccagcaggtcgcgcgccagttcttcctgagctcggaatac
agctacaagcgcaagctcggcgagatgctgctggcgatgcgcatggagcgcgagctcagc
aaggacgagatcttcgagctgtacttgaacaagagcttcttcggcaaccgcgcctacggc
gtcggcgccgccgccgagttctactacggcaagaagatgagcgagctctcgctcgacgaa
atggcctcgctcgcgggcattccgaaattcccgtccagcggcaacccgctcagcaatccc
gaccgcgccaagctgcgccgcgactacatcctcgaccgcatggccgagcagcgtttcatc
agcgccgacgaagccgcgcaggccaaggcggtgccgatgcacgccagcccgcacgagcgc
ccggtcgaggtctacgcgccctacgtggccgagatggtgcgccaggaaatgatcgcccgc
tacggcgccgaggcgctgaccaagggctatcacgtcaccaccaccatcgaccccaccctg
caggtcgcggccgacaaggcggtgcgcgacgggctctcggtctacgaccgccgccacggc
tggcacggggtcgagcagcacttcgacctcgccgccggcgaggacgccgcgaccgcgcgc
cagcgcctgcgcggcatcccggcccaggccaacctgttgcccgcggtcgtgctcggcagc
agcggcggccaggccaatgtcgtgctcggcgacggcaccgagctgacccttaccgagaag
cagggcttcggcggccgcagccccggcagcctggtcaagcgcggcgacgtggtgcgcatc
cagcgcaccgagaccgtgaccgagccggtggtcgctccggcggctccggccggcactgcg
gcagccgcagcggtcgtgccggccgtgccggccaaaccgccggtggtgagctaccgcctc
gaccaactgccgcaggcacaggccgcgctggtgtcgctggaaccgagcaacggcgccttg
cgcgcgctgtccggtggttacagttttgccggcgccaagttcaaccgcgccacccaagcg
cgtcgccagcccggctcgagcttcaagccgttcgtatacgcggccgcgttcgagcgcggc
tacaacccggcctcgatcgttctcgacgccccggtggtgttcaaggaccgccgcggccat
ctgtggcgtccgcagaacgacggcggtaacttcgccggcccgatgcgcgtgcgcgaagcg
atggtgcagtcgcgcaacctggtctcggtgcgcctgctcgacgccatgggcgtcgatttc
gcccgcaagtacatcagccacttcggcttcgacccggagcagctgccgccgaacctgtcg
atgtcgctcggcaccgcctcgctgacgccgctgtcggtcgcacgaggctattcggtgttc
gccaacggcggtttccgcatcactccgtggttcatcgacgaggtcaaggatcgcgctggc
gccgtggtgttcaaggaaaagccggccaccgcctgccccgaatgcggcggccgcggcggc
acctcggtcgccgtgccggtcagcaccgtcgtcgacggtttcgacctgggcccggccggc
ggcagcgccgacacggccaagcccgacccgaacaagcccgatccgaaggcgaagaaggcc
gaggacaagccggccgcgccgaagaaggaactgaccgcggccgagaaggcgagcatgaac
ctggcgccgcgcgcgatcgacgaccgcatcgcctaccagatcgtttcgatgctgcgcgac
gtggtcaagcgcggcaccggcaccgcggccaaggtgctcggccgcgaggacgtcggcggc
aagaccggctcgaccaacgaccatcgcgacgcctggttctccggcttcggcgggccttac
gtcaccacggtctgggtcggccgcgacaactacaagtcgctgggttaccgcgaatacggc
ggcaaggccgccctgccgatctggatcgactacatgcgcgtcgcgctgaaggaccagccg
ctcgccgtcaacgagccgccgcagggcatggtcaaggtgtccgtcgccggcaacggcgcg
ctgattcccgacggcgccggcggcgtgatcgagtgggtcaaggccgaagacctcgaacgc
atgcagacctataccgactacggcaacgaagaatcggcgccgtcggaagagtcctacgac
atcttctga

DBGET integrated database retrieval system