KEGG   Lysobacter antibioticus 76: LA76x_4258Help
Entry
LA76x_4258        CDS       T04154                                 

Definition
(GenBank) FAD binding domain protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lab  Lysobacter antibioticus 76
Pathway
lab00564  Glycerophospholipid metabolism
lab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LA76x_4258
Enzymes [BR:lab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LA76x_4258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 FAD_binding_2 GIDA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ALN82369
UniProt: A0A0S2FFQ8
LinkDB All DBs
Position
4867491..4869026
Genome map
AA seq 511 aa AA seqDB search
MSLPDVDLLVVGGGINGVAIARDAAGRGLSVLLCERDDIASHTSSASTKLIHGGLRYLEQ
FEFALVGKALAERKRLLRMAPHIIWPLRFVLPHQPHLRPAWMIRIGLFLYDRLGGRRGRG
LPGSRSVNLRKHITGRPLRDDFIHGFVYSDAWVQDARLAVLNAMDAAERGATVLTRTACV
SARRAEQAWDVRLRGADGVSRQVRARVLINATGPWAVRFLDQVAQVPHRHSLRLIKGSHI
VVPRLFEHDHAYIFQQPDRRIVFAIPYEHDYTLIGTTDVDYRADPSAPHIDEAETQYLCE
AASRYFKRAIQASDVVWTYSGVRPLLDDESDAASEITRDYLLTLDREGAPLLNVFGGKLT
TARKLAEEACDRLAPLFGGLRPAWTGTAPLPGGDLPDADFDAFHEDFSLRRPWLPDALAL
RLCRNYGSRALRIVESCSHLQDLGECFGADLYTAEVDYLVDCEWARSADDILWRRSKLGL
RIDAAGAMQLQGYVARRVAGRVDADVPAEDA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttgcccgatgtcgacctgctcgtcgtcggcggcggcatcaacggcgtcgccatc
gcccgcgacgccgccggccgcggcttgtcggtgctgctgtgcgaacgcgacgacatcgcc
tcgcacacctccagcgccagcaccaagctgatccacggcggcctgcgctatctcgaacag
ttcgagttcgccctggtcggcaaggccctggccgaacgcaagcgcctgttgcgcatggcc
ccgcacatcatctggccgctgcgtttcgtcctgccgcatcaaccgcatctgcgcccggcg
tggatgatccgcatcggcctgttcctgtacgaccggctcggcggccggcgcggacgcgga
ctgcccggttcgcgctcggtcaacctgcgcaagcacatcaccgggcggccgctgcgcgac
gacttcatccacggcttcgtctactccgacgcctgggtgcaggacgcgcgcctggcggtg
ctcaacgcgatggacgcggccgagcgcggcgcgaccgtgctgacccgcaccgcctgcgtc
tcggcgcggcgtgcagaacaggcttgggacgtacgcttgcgcggcgccgacggcgtgtcg
cggcaagtgcgcgcgcgtgtcctgatcaatgccaccggcccgtgggcggtacgcttcctc
gaccaagtcgcgcaggtgccgcaccggcacagcctgcgcctgatcaagggcagccacatc
gtcgtgccgcggttgttcgagcacgatcatgcctacatcttccagcaacccgatcgccgc
atcgtgttcgcgatcccgtacgagcacgactacaccctgatcggcaccaccgacgtcgac
taccgcgccgacccttcggcgccgcacatcgacgaggccgaaacccagtacctgtgcgag
gccgcctcgcgctatttcaagcgcgccatccaagcgagcgacgtggtctggacctacagc
ggcgtgcggcccctgctcgacgacgaaagcgacgccgcatcggaaatcacccgcgattac
ctgctcaccctcgaccgcgaaggcgcgccgctgctcaacgtgttcggcggcaagctgacc
accgcgcgcaagctggccgaggaagcctgcgaccggctcgcaccgctgttcggcggactg
cgcccggcctggaccggcaccgcgccgttgccgggcggcgatctgcccgatgccgatttc
gacgccttccatgaagacttcagcctgcgccggccgtggctgccggacgcgctggccctg
cgcctgtgccgcaactacggcagccgggcgctgcgcatcgtcgagagctgctcgcatctg
caagacctgggcgaatgtttcggcgccgacctgtacacggccgaggtcgattacctggtc
gattgcgagtgggcgcgcagcgccgacgacattttgtggcggcgctcgaagctcgggctg
cgcatcgatgcggctggcgcgatgcaactgcaggggtatgtcgcgcgacgcgtggcgggg
cgggtggatgcagatgtaccagcggaggacgcatga

DBGET integrated database retrieval system