KEGG   Lysobacter antibioticus 76: LA76x_4642Help
Entry
LA76x_4642        CDS       T04154                                 

Gene name
speE
Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
lab  Lysobacter antibioticus 76
Pathway
lab00270  Cysteine and methionine metabolism
lab00330  Arginine and proline metabolism
lab00410  beta-Alanine metabolism
lab00480  Glutathione metabolism
lab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LA76x_4642 (speE)
   00330 Arginine and proline metabolism
    LA76x_4642 (speE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LA76x_4642 (speE)
   00480 Glutathione metabolism
    LA76x_4642 (speE)
Enzymes [BR:lab01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     LA76x_4642 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N TraO Colicin_Pyocin Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: ALN82745
UniProt: A0A0S2FGT7
LinkDB All DBs
Position
5283896..5284762
Genome map
AA seq 288 aa AA seqDB search
MTTEPTWHYENFEPTGSSIGYRVTRKLDEVQSPFQKIEIFETTDWGNLMLIDGAVMLTTR
DNFLYHEMMSHPALFTHRAPKNVVIIGGGDCGTLREVLKHDGVTEAVQCDIDEQVTRMAE
KWFPELCDRNDDPRAQLLFDDGIAYMANRAPNSVDLIIVDSTDPVGPAEGLFNKAFYESC
FRALREDGILVQQSESPLMLIELIKEMRTEMGKAGFKTFKTLPFPQPCYPTGWWSCTLAR
KHADQKGGDFEFREADAQAKTFASKYYNAGIHRGALSTPAFVAEALGE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgaaccgacgtggcactacgaaaacttcgagccgaccggctcgtccatcggc
taccgcgtcacccgcaagctcgatgaagtccaatcgccgttccagaagatcgagatcttc
gagacgaccgactggggcaacctgatgctgatcgacggcgcggtgatgctgaccacgcgc
gacaacttcctgtaccacgagatgatgtcgcacccggcgctgttcacccatcgcgcgccg
aagaacgtggtcatcatcggcggcggcgactgcggcaccctgcgcgaagtgctcaagcac
gacggcgtgaccgaagcggtgcagtgcgacatcgacgagcaggtcacgcgcatggccgag
aagtggttcccggaactgtgcgaccgcaacgacgacccgcgcgcgcagctgctgttcgac
gacggcatcgcctacatggccaaccgcgcgccgaacagcgtcgacctgatcatcgtcgac
tccaccgacccggtcggcccggccgaaggcctgttcaacaaggccttctacgaaagctgc
ttccgcgccctgcgcgaggacggcatcctggtgcagcagtccgaatcgccgttgatgctg
atcgagctgatcaaggaaatgcgcaccgagatgggcaaggccggcttcaagaccttcaag
accctgccgttcccgcagccctgctaccccaccggctggtggagctgcaccctggcgcgc
aagcatgccgatcagaagggaggcgacttcgagttccgcgaagccgacgcccaggccaag
accttcgccagcaagtactacaacgccggcatccaccgcggcgcgctgtcgaccccggcc
ttcgtcgccgaagcgctgggcgagtaa

DBGET integrated database retrieval system