KEGG   Labrenzia sp. PHM005: FJ695_12775Help
Entry
FJ695_12775       CDS       T06152                                 

Gene name
gatA
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
labp  Labrenzia sp. PHM005
Pathway
labp00970  Aminoacyl-tRNA biosynthesis
labp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:labp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FJ695_12775 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:labp03029]
    FJ695_12775 (gatA)
Enzymes [BR:labp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     FJ695_12775 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     FJ695_12775 (gatA)
Mitochondrial biogenesis [BR:labp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    FJ695_12775 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: QDG76674
UniProt: A0A4Y6RWA8
LinkDB All DBs
Position
complement(2849013..2850497)
Genome map
AA seq 494 aa AA seqDB search
MTDLTKLTIAEAREGLKNKDYTSTELTEAFIGNIEKANGALNAYVAVTADKAREMAKASD
DKLAKGEGGALEGIPLGIKDLFGTEGIHTQACSHILDGFKPAYESTVTSNLWADGAVMLG
KLNMDEFAMGSSNETSYYGDVINPWRKKGSNQDLVPGGSSGGSAAAVAARMCMGATATDT
GGSIRQPAAFTGTVGIKPTYGRCSRWGVVAFASSLDQAGPIAHTVRDSAILLKSMASVDP
KDTTSVDIEVPDYEAAIGKSVKGLKIGIPAEYRLDGMPGEIDELWQKGIQWLKEAGAEIV
DIAMPHTKYALPAYYIVAPAEASSNLARYDGVRYGLRVPGKDIVEMYENTRAEGFGDEVK
RRILIGTYVLSAGYYDAYYLKAQKVRTLIKRDFDLAWQNGVDAILTPATPSAAFGVADQD
LHSDPVKMYLNDIFTVTVNMAGLPGISVPAGLSGDGLPLGLQLIGKPFDESTLFQVGQVI
EDAAGSFEPEAWWG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttacaaaactgaccattgccgaggcccgcgagggactgaagaacaaggac
tacacgtccacagaactcaccgaagcctttatcggcaacatcgagaaagccaacggagcg
ctgaacgcctatgtggctgtcaccgccgacaaggcccgcgagatggccaaggcctccgac
gacaagctcgccaaaggtgaaggcggtgcgctggaaggcatcccgcttgggatcaaggat
ctatttggcaccgaaggcattcacacccaggcctgctcgcacattctggatggtttcaaa
ccggcttacgaatccacggtaacatccaacctgtgggccgacggcgcagtgatgctcggt
aagctcaacatggatgagttcgcgatgggttcgtccaacgagacctcttactacggtgac
gttatcaacccgtggcgcaagaagggctccaaccaggatctggtcccgggcggttcgtcc
ggtggctctgccgcagctgtcgcggcccgtatgtgcatgggcgcaacggccaccgacacc
ggcggctccatccgccagccggcagcgttcaccggcacggtcggtatcaagccgacttat
ggacgctgctcccgctggggcgttgtcgccttcgcctcctcgctcgatcaggccggccca
atcgcccacaccgtgcgcgacagcgcgattcttttgaaatccatggcttcggttgatccg
aaagacaccacgtcggtcgacatcgaggttccggattatgaagcagccatcggaaaatcc
gtgaagggcctgaaaatcggcattccggccgagtaccgtcttgatggcatgccgggtgaa
atcgatgaactgtggcagaagggcattcaatggctgaaggaagcgggcgcggagatcgtc
gacattgccatgccacacaccaaatacgccctgccggcctattacattgtggcgccagcc
gaagcctcgtccaacttggcccgttatgacggcgtgcgttatggcctgcgcgttccgggc
aaagacatcgtggagatgtatgaaaacacccgcgctgaaggctttggtgacgaggtcaag
cgccggatcctgatcggcacctatgtgctgtctgccggttactacgacgcttactatctg
aaagcccaaaaggtccgcacgctgatcaagcgcgactttgacctggcctggcagaacggt
gtcgacgccatcctaaccccggccacaccatcagcagcctttggcgttgccgatcaggat
ctgcattccgatcctgtgaaaatgtacctgaacgacatcttcactgtgaccgtgaacatg
gccggcctgccgggcatttctgtgcctgccggcctttcaggcgatggccttccgctcggc
ctgcagctgatcggcaaaccgttcgacgagagcacactgttccaggtcggtcaggtcatc
gaagacgctgcaggttccttcgagccagaggcttggtggggctaa

DBGET integrated database retrieval system