KEGG   Labrenzia sp. VG12: CHH27_00265Help
Entry
CHH27_00265       CDS       T04984                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00061  Fatty acid biosynthesis
labr00780  Biotin metabolism
labr01100  Metabolic pathways
labr01130  Biosynthesis of antibiotics
labr01212  Fatty acid metabolism
Module
labr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:labr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CHH27_00265
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CHH27_00265
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CHH27_00265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:labr01004]
    CHH27_00265
Enzymes [BR:labr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CHH27_00265
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CHH27_00265
Lipid biosynthesis proteins [BR:labr01004]
 Fatty acid synthase
  Component type
   CHH27_00265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ASP36531
UniProt: A0A222FDN7
LinkDB All DBs
Position
63716..64480
Genome map
AA seq 254 aa AA seqDB search
MFDLTGHKALVVGVANDQSIAYGCARAFRAQGADLAITYLNERAESFVRPLAEQLDAEII
APLDVRDDSQMDALFAEIAGKWGRLDTLLHSIAFSKKEDLHGRVVDCSADGFGLAMDISV
HSFLRLIRRSEPLMPQGGTCMTVSFMGAQKVVENYGVMGPVKAALEAATRYAAAEMGPKG
ISVHALSPGPLKTRAASGIAEFDALLNDAASRAPTHHLATIDDVGAYAAFLASREAFNVT
GSVHAIDGGYSILG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatttgacgggacataaggcccttgttgtcggcgtcgcgaatgaccagtccatc
gcctacggctgcgccagggcgttccgcgcgcaaggggccgatctcgcaatcacttatctg
aacgagcgggccgaatcctttgtccgcccgctggccgaacagctggatgctgaaatcatt
gcgcccctggatgtgcgcgacgacagccagatggatgccttgttcgcagagattgcaggc
aagtggggccggctcgatacattgttgcactccatagccttttccaaaaaggaagacctt
cacgggcgtgtggtcgactgttctgcggacggctttgggctggccatggacatttcggtt
cactcttttctccgcttgatccgccggtccgagccgttgatgccgcaagggggaacctgc
atgacggtctcgttcatgggcgcgcagaaggtggtcgaaaattacggcgtcatggggccg
gtcaaggctgcgctcgaagcggcgacgcgctatgctgctgcggaaatggggccgaagggt
atctcggtccatgcattgtcgccgggaccgctgaaaacccgggctgcctccggcatcgcc
gagtttgacgcccttctgaatgacgcggcgtcccgggcaccgacccatcatctggcgacg
atcgacgatgtcggcgcctatgccgcgttccttgccagccgagaggccttcaacgtcacc
ggttccgtgcatgccatcgatggcggctacagcattcttggatag

DBGET integrated database retrieval system