KEGG   Labrenzia sp. VG12: CHH27_12650Help
Entry
CHH27_12650       CDS       T04984                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00240  Pyrimidine metabolism
labr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:labr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CHH27_12650
Enzymes [BR:labr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CHH27_12650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 DUF2075 AAA_14
Motif
Other DBs
NCBI-ProteinID: ASP36824
UniProt: A0A222FEC1
LinkDB All DBs
Position
2702302..2702880
Genome map
AA seq 192 aa AA seqDB search
MAKLYFNYSTMNAGKSTLLLQAAYNYQERGMNTLLMIASFDDRAGTGRIASRIGLGADAD
VFSPQDDVFNHIETRSNAGKIDAVLVDEAQFLTEAQAWQLANVADQLRIPVMCYGLRTDF
QGKLFPGSAALLALADNLKEVKTICWCGRKATMVARLDADGNIVEEGNQVEIGGNDKYVS
LCRLHWSRRELG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttcaactattccacgatgaacgccggcaagtcgaccttgctgctg
caggccgcctacaattaccaggagcgcggcatgaacacgttgctgatgatcgcctccttc
gacgacagggcgggcacaggccgcatcgcctcgcggatcggactgggggccgatgccgac
gtcttctctccgcaggacgatgtgttcaaccacatcgaaacccgcagcaacgcgggcaag
atcgatgctgttctggtcgatgaagcccagtttctgacggaagcacaggcctggcaactt
gccaatgtcgccgaccagctgcgcattccggtcatgtgttacggcctcaggacggacttc
cagggcaagctctttcccggcagtgccgccctgcttgcgcttgccgacaatctgaaagag
gtcaagaccatctgctggtgcggccgcaaggccaccatggtcgcccgcctggatgccgac
ggcaacattgtggaggaaggcaaccaggtcgagatcggcggcaacgacaaatatgtctcg
ctgtgccgccttcactggagcagacgggaattgggatag

DBGET integrated database retrieval system