KEGG   Labrenzia sp. VG12: CHH27_17240Help
Entry
CHH27_17240       CDS       T04984                                 

Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00220  Arginine biosynthesis
labr01100  Metabolic pathways
labr01110  Biosynthesis of secondary metabolites
labr01130  Biosynthesis of antibiotics
labr01210  2-Oxocarboxylic acid metabolism
labr01230  Biosynthesis of amino acids
Module
labr_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:labr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CHH27_17240
Enzymes [BR:labr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     CHH27_17240
    2.3.1.35  glutamate N-acetyltransferase
     CHH27_17240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ DUF2529
Motif
Other DBs
NCBI-ProteinID: ASP34763
UniProt: A0A222F988
LinkDB All DBs
Position
complement(3737676..3738917)
Genome map
AA seq 413 aa AA seqDB search
MSTTVSPLAPTSYPEMPDISGVAFATASAGIKYQGRTDVLLATVAEGTAVAGVFTKSKCS
SAPVDWCKARIGAGRARALLVNSGNANAFTGKKGMAAVELSADIVSGALGCSGDEIFLAS
TGVIGEPLPAEKFSDVVEELKAGQGSASWLDAAKAIMTTDTYPKVATAAVELDGVTVTIN
GIAKGAGMIAPDMATMLSFVFTDAPIAPDVLQALLSGEVDGSFNAITVDSDTSTSDTVLL
FATGAASENGVEAVASLEDPRVGVLRAALSDVMVDLAHQIVRDGEGARKFVEVRVEGADN
NASAKRIALSIANSPLVKTAIAGEDANWGRVVMAVGKAGEPADRDRLAIWFGDVRVAVVG
ERDPAYSEEAASAVMKQEDIVIRVELGLGSGQASVWTCDLTKEYVAINGDYRS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgaccgtttcaccgctcgcccccacttcctatcccgagatgcccgacatcagc
ggcgtggcatttgcgaccgcctctgccggtatcaagtatcagggccggacggatgtgctg
ctggcgactgttgccgagggcacggccgttgccggggtgttcacgaaatccaagtgctcg
tcggcgccggtggattggtgcaaggcccggatcggtgcaggcagggcccgggctcttctg
gtcaactccggcaatgccaatgcctttacaggaaaaaaaggcatggcggctgttgaattg
tccgcagacattgtttccggggccctgggctgttccggtgacgagatttttcttgcctca
accggcgtgatcggtgagccgctgccggcggaaaagttttcagatgtcgtcgaagagctg
aaggctggtcagggcagcgcgtcctggctggatgccgccaaggccatcatgaccaccgat
acctatccgaaagtcgctaccgcggcggtagaactcgatggtgtgacggtcacgatcaac
ggcatagccaaaggcgccggcatgatcgcgcctgacatggcgacgatgctgtcatttgtt
ttcaccgatgcaccaattgctcccgatgtcctgcaggctctgttgagcggtgaggtcgat
ggcagtttcaacgcaatcaccgtcgatagcgatacctccacgtccgacacggttctcctg
ttcgcaacaggcgcggcctccgaaaacggtgtcgaggccgttgcatcgcttgaagacccg
cgtgtgggtgtcctgcgtgcggccctgagcgacgtcatggtcgatctcgcgcaccagatc
gtccgcgacggcgaaggcgcacgcaagtttgtcgaagtccgggtcgaaggggctgacaac
aatgcctcagccaaaagaattgcgctttcaatcgcaaattcgcctttggtcaagacggcc
attgccggcgaagacgcaaactgggggcgtgtcgtcatggctgtcggcaaggccggagaa
cccgcggatcgcgaccggcttgccatctggttcggcgatgtgcgcgtggcggtggtgggc
gagcgtgaccccgcctacagcgaagaggctgcctctgccgtcatgaagcaggaagacatc
gttatccgcgtcgagcttggacttggatcggggcaggcgtcggtgtggacctgtgacctc
accaaggaatatgtcgccatcaatggcgattaccggagctag

DBGET integrated database retrieval system