KEGG   Labrenzia sp. VG12: CHH27_21930Help
Entry
CHH27_21930       CDS       T04984                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00020  Citrate cycle (TCA cycle)
labr00310  Lysine degradation
labr00380  Tryptophan metabolism
labr01100  Metabolic pathways
labr01110  Biosynthesis of secondary metabolites
labr01120  Microbial metabolism in diverse environments
labr01130  Biosynthesis of antibiotics
labr01200  Carbon metabolism
Module
labr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
labr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:labr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHH27_21930
  09105 Amino acid metabolism
   00310 Lysine degradation
    CHH27_21930
   00380 Tryptophan metabolism
    CHH27_21930
Enzymes [BR:labr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CHH27_21930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ASP35567
UniProt: A0A222F902
LinkDB All DBs
Position
4729212..4732199
Genome map
AA seq 995 aa AA seqDB search
MARQEANNVFALTSLLYGANAAYIEDLYAQYKTDPNSVDAEWRDFFAAFQDEKDAVLKEA
RGATWKRKDWPIEANGDLVNAFDGNWGPIEQKIGDKLKKKAEAKGAPISDTEVHQATRDS
VRALMMIRAYRMRGHLHADLDPLGLAGKGDHEELHPSSYGFVEADWDRKIFIDHVLGLEY
ATIREMLEILKRTYCSTLGVEFMHISDPAAKAWIQERIEGPDKQVAFTSEGKKAILNKLV
EAEGFEKFLDVKYTGTKRFGLDGGEALIPALEQIIKRGGQMGLKDIVLGMAHRGRLNVLS
QVMGKPHRAIFHEFKGGSYAPDEVEGSGDVKYHLGASSDRTFDDNNVHLSLTANPSHLEI
VNPVVLGKSRAKQDQLAADENGNFIETTEVDRGTVLPLLLHGDAAFAGQGVVAECFGLSA
LRGHRTGGSIHVIINNQIGFTTNPRFSRSSPYPSDMAKVIESPIFHVNADDPEAVVFAAK
IAIEFRQTFHRPVVIDMICYRRFGHNEGDEPAFTQPIMYRKIRKHATTLQLYSERLVNEG
VLSQEEVDRMKADWRKHLDIEFDSGQAFKPNKADWLDGKWSGLKRADDEEDPRRGETGLP
VDELKEIGRALTHVPDGFNIHRTIARFMNHRERMVETGEGIDWATAEALAFASLLKEGHP
IRLSGQDCERGTFSQRHSVLYDQEDESRYIPLNHISPDQQRYEVINSMLSEEAVLGFEYG
YSLAEPRALTMWEAQFGDFANGAQVLFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHS
SARLERFLQLCAEDNMQVANCSTPANYFHILRRQLRRDIRKPLILMTPKSLLRHKKAVSK
IEELGPDSTFHRLLWDDWGHNLNADGKLVADDKIRRVVMCSGKVYYDLFEEREKRGINDV
YLMRVEQLYPFPKKALMLELARFPQAEMVWCQEEPKNMGSWFFVEPYIEWVLGQIDAKHQ
RPRYAGRNAMASTATGLMSAHLAQLQAFLEEALGD
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcaggaagcgaacaacgtattcgcactgacgtcgttgctttacggcgccaac
gcagcctatatcgaagacctctacgcacagtacaagacagatccgaactcggttgatgcc
gagtggcgggacttctttgctgccttccaggacgagaaagacgccgtcctgaaggaagca
cgcggggcaacctggaaacgcaaggactggccgatcgaggccaatggcgacctggtcaac
gcctttgacggcaactggggtccgatcgaacagaagatcggcgacaagctgaagaagaag
gcggaagccaagggcgcgccgatttccgacacagaggtccatcaggcgacgcgcgattcc
gtgcgtgccctgatgatgatccgtgcctaccggatgcgcggtcacctgcacgccgatctc
gatccgctcgggctggccggcaagggcgaccatgaagaactgcacccgtcttcctatggc
tttgtcgaagccgactgggaccgcaagatcttcatcgatcacgtgctcggcctcgaatac
gccaccatccgcgagatgctggagatcctgaagcggacctattgctcgacccttggcgtc
gagttcatgcacatttccgatccggccgccaaggcctggatccaggagcgcatcgaaggc
ccggacaagcaggtggccttcacctcggaaggcaagaaggcgatcctgaacaagctggtc
gaggctgagggcttcgaaaagttcctggacgtcaaatacaccggcaccaagcgtttcggc
ctggatggcggcgaggccctgatcccggcgcttgagcagatcatcaagcgtggcggccag
atgggtctgaaggacatcgtgctcggcatggcccaccgtggccgtctgaacgtgctgtcc
caggtgatgggcaaaccgcatcgcgccattttccacgagttcaagggcgggtcctacgcc
ccggacgaagtggaaggctccggcgacgtgaagtaccacctcggtgcgtcctccgaccgg
accttcgacgacaacaacgttcacctgtcgctgacggcgaacccgtcgcacctggaaatc
gtgaacccggtcgtcctcggcaagtcccgcgccaagcaggaccagctcgcagcggacgaa
aacggcaacttcatcgagacgaccgaagtcgatcgcggcacggttctgccgctgctgctg
cacggcgatgcggcctttgccggccagggtgtcgtggccgagtgtttcggtctgtccgcc
ctgcgcgggcaccgcaccggcggctcgatccatgtgatcatcaacaaccagatcggcttc
accaccaacccgcgattctcgcgttcctcgccctatccgtcggacatggcgaaggtgatc
gaatcgccgatcttccacgtcaatgcggatgatccggaagcggttgtcttcgcggcgaag
atcgcgatcgagttccgccagacgttccaccgccccgtcgtcatcgacatgatctgctac
cgccgcttcggccacaacgagggcgacgagccggcgttcacgcagccgatcatgtaccgc
aagatccgcaagcacgcgacgacgcttcagctctattccgagcgcctggtcaatgaaggc
gttctgagccaggaagaagtcgaccggatgaaggccgactggcgcaagcatctggacatc
gagttcgacagcggccaggccttcaagccgaacaaggccgactggctggacggcaagtgg
tccggcctgaaacgggccgatgacgaagaagatccgcgccgcggcgaaaccggtcttccg
gttgacgaattgaaggaaatcggccgggcgctgacccatgtgccggatggcttcaacatt
caccgcacgattgcgcgcttcatgaaccaccgggagcgcatggtcgagaccggagagggc
atcgattgggccaccgccgaagcgctcgcattcgcgtcgcttctgaaggaaggccatccg
atccgcctgtccggtcaggactgcgaacgcggcaccttctcgcagcgccactccgtgctc
tacgaccaggaagacgaaagccgctacattccgctgaaccacatttcgcccgaccagcag
cgctacgaggtcatcaactcgatgctgtcggaagaggctgtgcttggctttgaatacggc
tattcgctggccgagccgcgggcgctgaccatgtgggaagcccagttcggcgactttgcc
aatggcgcgcaggttctgttcgaccagttcatctcgtcgggcgaacgcaagtggttgcgc
atgtccggtctcgtctgccttctgccgcatggctacgagggccagggtccggaacactcc
tccgcccgcctggagcgtttccttcaactctgcgcggaagacaacatgcaggtggcgaac
tgttcgacaccggccaactacttccacatcctgcgccgtcagctgcgccgcgacatccgc
aagccgctgatcctgatgacgccgaaatcgcttctgcgtcacaagaaggcggtatcgaag
atcgaggaactcggtccggattcgaccttccaccggctgctctgggacgactggggccac
aacctcaatgccgacggcaagctggttgcggacgacaagatccggcgggtcgtgatgtgt
tcgggcaaggtctattacgacctcttcgaagagcgcgagaagcgcggcatcaacgacgtc
tacctgatgcgtgtcgagcagctctacccgttcccgaaaaaggcgctcatgcttgaactg
gcgcgcttcccgcaggccgagatggtctggtgtcaggaagagccgaaaaacatgggcagc
tggttcttcgtcgagccgtatatcgagtgggtcctgggtcagatcgacgccaagcaccag
cgcccgcgctatgccggccgcaatgcaatggcctcgaccgcgaccggtctgatgtccgcg
catctggcgcagctgcaggcgttcctcgaagaagcgctcggagactaa

DBGET integrated database retrieval system