KEGG   Labrenzia sp. VG12: CHH27_26975Help
Entry
CHH27_26975       CDS       T04984                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
labr  Labrenzia sp. VG12
Pathway
labr03030  DNA replication
labr03410  Base excision repair
labr03420  Nucleotide excision repair
labr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:labr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CHH27_26975
   03410 Base excision repair
    CHH27_26975
   03420 Nucleotide excision repair
    CHH27_26975
   03430 Mismatch repair
    CHH27_26975
Enzymes [BR:labr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CHH27_26975
    6.5.1.6  DNA ligase (ATP or NAD+)
     CHH27_26975
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CHH27_26975
DNA replication proteins [BR:labr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CHH27_26975
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CHH27_26975
DNA repair and recombination proteins [BR:labr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CHH27_26975
   NER (nucleotide excision repair)
    Other NER factors
     CHH27_26975
   MMR (mismatch exicision repair)
    Other MMR factors
     CHH27_26975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ASP36441
UniProt: A0A222FDF1
LinkDB All DBs
Position
5846035..5847690
Genome map
AA seq 551 aa AA seqDB search
MQCFSQLLDRLSLEPRRLAKEALLVRYFRDTPDPDRGYALAALTGGLSFKHAKPALLRGL
ISERADPQLFALSYDFVGDLSETIALMWPRQERSLAAASPDAPGLAQVVEMLAGSGKTDV
PGLLAGWLDALDETGRWALLKLVTGGLRVGVSARLAKSAVARLGELEVDRVEEVWHGLKV
PYEPLFAWAEGRAGPPETDDPAPFRPAMLAHPLDVEKDTPQLAAADFAVEWKWDGIRVQA
AAGKTSDGQEVRRLFSRTGEDISRAFPDIVDLLGFEASIDGELLVVSEGKVRPFSDLQKR
LNRKTAGPKLLREYPAAIRAYDLLALEGTDLRDRPLADRRKLLEDFVQGLSNPRIDLSPM
VEVASWEEITAARAAPQDHLAEADAEAVEGLMLKRWDAPYVPGRPKGQWFKWKREPHLVD
AVLMYAQRGHGKRSSFYSDYTFGVWRDGDNGLELVPVGKAYFGFTDEELREIDRFVRNNT
TNRFGPVREVAYGPETGLVLEVAFEGLNRSGRHKSGVAMRFPRIARLRWDKPAAEADRLE
TLEALLPRETG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgcttttcccaactactggacaggctttccctggagccgcgccgccttgccaag
gaggccctgcttgtccgctattttagagacacgcccgatcctgaccggggatacgccctg
gcagctctgaccggcggactgtccttcaaacatgccaaaccggctcttctcagaggcctg
atcagtgagcgggcagacccgcagctgttcgcgctttcctatgattttgtcggcgatctt
tctgagaccatcgcgctcatgtggccaagacaggaaaggtctctggccgccgcgtcgccg
gatgcaccgggtcttgcacaggtcgtcgagatgcttgccgggtctggaaagacagacgtg
cctggtctgctcgccggctggttggatgcgcttgatgaaacagggcgatgggccttgctc
aagcttgtgacaggtggattgcgtgtgggcgtatcggcgcgtctggcgaagtctgccgtg
gcacgcttgggtgaactggaagtggaccgggtcgaggaggtctggcacgggctgaaggtc
ccgtacgaacccctgttcgcctgggccgagggaagggccggcccgcccgagactgatgat
ccggcgccattccgtccggcgatgctggcccacccgcttgatgtcgaaaaggacacacca
cagctcgcggcggcggactttgcagttgaatggaaatgggacggcattcgggttcaggcc
gctgcgggaaaaacctccgatggccaggaggtcaggcgccttttcagccggacgggtgag
gatatctccagagcctttccggacatagtcgacctgctgggcttcgaagcatcgatcgat
ggagagctgctggtggtgtcggagggcaaggtcaggccgttttccgatctgcagaagcgg
ctcaatcgcaagacggccggcccgaaactgttgcgcgagtaccctgccgcgatccgtgcc
tatgaccttctggccctggaggggacggacctgcgcgaccgtcccctcgccgaccgtcgc
aagctgcttgaagatttcgtgcaaggactttccaatccccgaattgacctctcgccaatg
gtggaggtggccagctgggaggagatcacggcggcgcgtgcagctccgcaggatcatctg
gctgaggccgacgcggaggccgttgaaggtctgatgctgaaacgctgggatgcaccctat
gtgccgggccgcccaaaggggcaatggttcaaatggaagcgcgagccgcatctggtcgac
gctgtcctgatgtatgcacaaagaggtcacggcaaacgatcgtctttctattccgattac
acgttcggtgtctggcgagacggggacaacgggctcgaacttgtgcccgtcggcaaggcc
tatttcggcttcaccgacgaagagctcagggaaatcgaccggttcgtgcgcaacaacacg
accaaccgcttcggccctgtgcgggaagtggcctacggtcccgagacgggcctggttctg
gaagtggcgtttgagggtctcaatcggtccgggcgtcacaaatcgggtgttgccatgcgg
tttcccaggatcgcacgccttcgttgggacaaaccggctgccgaggcggaccggctggaa
acactggaagccctgctgccgcgtgaaacagggtga

DBGET integrated database retrieval system