KEGG   Lactobacillus acidipiscis: LAC1533_0577Help
Entry
LAC1533_0577      CDS       T05349                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
laca  Lactobacillus acidipiscis
Pathway
laca00010  Glycolysis / Gluconeogenesis
laca00260  Glycine, serine and threonine metabolism
laca00680  Methane metabolism
laca01100  Metabolic pathways
laca01110  Biosynthesis of secondary metabolites
laca01120  Microbial metabolism in diverse environments
laca01130  Biosynthesis of antibiotics
laca01200  Carbon metabolism
laca01230  Biosynthesis of amino acids
Module
laca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
laca_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:laca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAC1533_0577
  09102 Energy metabolism
   00680 Methane metabolism
    LAC1533_0577
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAC1533_0577
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:laca04131]
    LAC1533_0577
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:laca04147]
    LAC1533_0577
Enzymes [BR:laca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LAC1533_0577
Membrane trafficking [BR:laca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LAC1533_0577
Exosome [BR:laca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LAC1533_0577
  Exosomal proteins of melanoma cells
   LAC1533_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: SFV39997
UniProt: A0A1K1KM70
LinkDB All DBs
Position
I:635223..635909
Genome map
AA seq 228 aa AA seqDB search
MPKLVFIRHGQSEWNLKNLFTGWVDVDLSEKGVQEATEAGKKLKEAGIEFDQAYTSVLTR
AIKTLHIALEESGQLWIPETKTWRLNERHYGALQGQNKKEAAEKFGEEQVHTWRRSYDVL
PPLLKADDEGSAVKERRYANLDPHVVPGGENLKVTLERVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYLEGISDDDIVSLEMATGQPVVYDLDDKLNVVNKEKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtattcatccgtcacggacaaagtgaatggaacttaaagaaccttttt
acgggctgggttgacgttgacctgagcgaaaaaggtgtacaagaagctacagaagcaggt
aaaaaacttaaagaagctgggatcgaatttgaccaagcttatacatcagttttgacacgt
gctatcaagactttgcacattgctttggaagaaagcggccaattatggatccctgaaacc
aagacatggcgtttgaacgaacgtcactatggtgcattgcagggccaaaacaaaaaagaa
gctgctgaaaaatttggtgaagaacaagttcatacatggcgtcgttcatacgatgtttta
ccaccacttttgaaggctgatgacgaaggttctgctgttaaggaacgtcgttatgctaac
ttggatccacatgttgttccaggcggtgaaaacttgaaggttactttggaacgtgtcatg
ccattctgggaagaccatattgctccagatcttttggacggtaaaaacgtgattatcgca
gcccatggtaattcattgcgtgctttgactaagtatcttgaaggtatctcagatgatgat
atcgtcagcttagaaatggctacaggccaaccagttgtttacgacttggatgacaagcta
aacgtggttaacaaagaaaaactttaa

DBGET integrated database retrieval system