KEGG   Lacinutrix sp. Bg11-31: CW733_02020Help
Entry
CW733_02020       CDS       T05225                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
laci  Lacinutrix sp. Bg11-31
Pathway
laci00071  Fatty acid degradation
laci00280  Valine, leucine and isoleucine degradation
laci00281  Geraniol degradation
laci00362  Benzoate degradation
laci00592  alpha-Linolenic acid metabolism
laci01100  Metabolic pathways
laci01110  Biosynthesis of secondary metabolites
laci01120  Microbial metabolism in diverse environments
laci01130  Biosynthesis of antibiotics
laci01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:laci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CW733_02020
   00592 alpha-Linolenic acid metabolism
    CW733_02020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CW733_02020
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CW733_02020
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CW733_02020
   00642 Ethylbenzene degradation
    CW733_02020
Enzymes [BR:laci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     CW733_02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AUC80974
UniProt: A0A2K8XDG7
LinkDB All DBs
Position
complement(443866..445059)
Genome map
AA seq 397 aa AA seqDB search
MKTAYIVKAYRTAVGKAPKGVFRFKRTDELAAETIKYMMKELPGLDPKRIDDVIVGNAMP
EGAQGLNMARLISLMGLEIVDVPGVTVNRFCSSGVETIGMATAKIQAGMADCIIAGGAES
MSSVPMTGFKPELNYDAIVKGGHEDYYWGMGNTAEAVAKQFKISREDQDEFTFNSHMKAL
RAQAENRFQDQIVPIEVEQTYIDANGKKATKSYTVTKDEGPRAGTSKEALAKLRAVFAAG
GSVTAGNSSQMSDGAAFVMVMSEDMVKELGLEPIARMVNYAAAGVEPRIMGIGPVKAIPK
ALKQAGLKQDDLSLIELNEAFASQSLAVIRELNLNPDIINVNGGAIALGHPLGCTGAKLS
VQLFDEMRKQNMQGKYGAVTMCVGTGQGACGVFEFLS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcatatatagtaaaagcatatagaacagcagttggtaaagcaccaaaaggc
gtgttccgttttaaaagaacagatgaattggcagcagaaaccatcaaatacatgatgaag
gaattgcctggtttagatccaaaacgtattgacgatgttattgttggtaacgcaatgcct
gaaggtgctcaaggattaaatatggcgcgtttaatctctttaatgggattagaaattgtt
gatgttcctggtgtaacagttaatcgtttttgctcttcaggagtagaaactattggtatg
gcaacagcaaaaatacaagccggaatggcagattgtattatagcaggtggagctgaaagt
atgagtagtgtcccaatgactggttttaaaccagaattaaattatgacgctattgtaaaa
ggaggccatgaagattattattggggaatgggaaatactgcagaagctgttgcaaagcaa
ttcaaaatatctcgtgaagatcaagatgaatttacatttaattctcatatgaaagcatta
agagcgcaagctgaaaatcgttttcaagatcaaattgtaccaattgaagtagagcaaaca
tatattgatgctaacggaaagaaagcaacaaaatcttatacagtaactaaagatgaagga
cctcgagcaggaactagtaaagaagctttagcaaaactaagagcagtatttgctgctgga
ggaagtgttactgctggtaactcatctcaaatgagtgatggtgctgcttttgtaatggtt
atgagtgaagacatggttaaagaactaggtttagagccaattgcaagaatggtaaactat
gctgctgctggtgttgagcctcgtattatgggtattggacccgttaaggctattccaaaa
gcattaaaacaagcaggtttaaaacaagatgatttatcgttaattgaattgaatgaagct
tttgcttctcaatctttagcagttattcgtgagttaaacttaaatccagatattattaac
gtaaatggtggtgctattgcacttggtcacccattaggttgtacaggagcaaaactatct
gtacagttatttgatgaaatgcgtaagcaaaacatgcaaggtaaatatggtgcagtaaca
atgtgtgtaggtactggacaaggtgcttgtggagtatttgaatttctttcttaa

DBGET integrated database retrieval system