KEGG   Lacinutrix sp. Bg11-31: CW733_10135Help
Entry
CW733_10135       CDS       T05225                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
laci  Lacinutrix sp. Bg11-31
Pathway
laci00620  Pyruvate metabolism
laci00680  Methane metabolism
laci01100  Metabolic pathways
laci01120  Microbial metabolism in diverse environments
laci01200  Carbon metabolism
Module
laci_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:laci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CW733_10135
  09102 Energy metabolism
   00680 Methane metabolism
    CW733_10135
Enzymes [BR:laci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CW733_10135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AUC82466
UniProt: A0A2K8XI40
LinkDB All DBs
Position
2250267..2252846
Genome map
AA seq 859 aa AA seqDB search
MPIQPKLTRFNQNVLAKYQIYNSIFMTLPFDTITKTGALLPLFHETCKKGFAKQDNPTAI
VETFFKKYQSSRSPESQTNLLFKFIQYIERQVVLFDAIEDAAFPLVNNMDGIGTLRSLKE
SATAENKLETLKAYLEEFKVRIVLTAHPTQFYPGSVLGIITDLTEAIRENDLLKINDLLA
QLGKTPFFKHEKPTPYDEAVSLIWYLENVFYKSFGSIYDYIQQNIFDGAHIDNDIINIGF
WPGGDRDGNPFVTPEITLKVANRLRETVIKNYYRDVRRLKRKLSFQGVEERVTILERELY
KMITNQEPNLTLDSFTSELKEIKEIIIDKHQSLYVTEVNSLLNKVHLFGFHFANLDIRQD
SRKHEQYFNDMVNTLIESGSTIFPKNYHDLPENEQVQILSKVEGEVDLSLIKDEETLKAL
NTMKAIKTIQTTNGEVAANRYIISNNQTTLHVMQLFAMLKLVAFQDKLTVDVGPLFETIT
DLENAPQVMEELYTNPQYAAHLKSRGNKQTIMLGFSDGTKDGGYLMANWAIYKAKENLTT
ISRQHGITVIFFDGRGGPPARGGGKTHNFYASLGPTIEDKEVQLTIQGQTISSNFGTLDS
SQYNLEQLISSGIHNSLSDKDLSMLPENRAVMTDLSERSYEAYSAFKAHPKFISYLEHMS
TLKYYAKTNIGSRPSKRGKAEGLVFEDLRAIPFVGSWSQLKQNVPGFFGVGTALKHYEDT
NTFEKAQKLFKTSDFFKTLIENSMMSLSKSFFDLTKYMSEDEEYGGFWNVIYEEYKTSKR
LLLKLTGYTELMQEEPAGSASIAVRESIVLPLLTIQQFALKKIQELEKAEVRDDAQIAIY
EKLVTRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgcctatacaaccaaaacttacacggtttaatcaaaatgttttagcaaagtatcaaata
tacaatagtatatttatgacacttcctttcgataccataacaaaaacaggcgcactttta
ccactctttcatgagacttgcaaaaaaggttttgcaaagcaagataacccaacagctatt
gttgagacgttttttaaaaagtaccaatctagtcgctctccagagagtcagaccaattta
ctatttaaatttattcaatatatagaacgccaagttgtattgtttgatgctattgaagat
gctgcttttccattagtaaacaacatggatggtattggaaccttacgtagtttaaaagaa
agtgctacagccgaaaataaactagaaacacttaaagcgtatttagaagagtttaaagtt
cgtattgtactaaccgcacatccaacacaattttacccaggttcggttttaggtattatt
acagatttaaccgaagctattcgtgaaaatgatttacttaaaataaatgatttattagca
caactagggaaaacaccattttttaaacatgaaaaaccaacgccttacgatgaggctgtg
agtttaatatggtatttagaaaatgtgttctacaaatcttttggatctatttacgattac
attcaacaaaatattttcgacggagcacatattgataacgatattattaatattggtttt
tggcctggaggagacagagatggaaatccatttgtaactccagaaataactttaaaagtt
gccaatagattacgcgaaacagttattaaaaattattatcgcgacgtaagacgtttaaaa
agaaaattatcttttcaaggtgtcgaagaacgtgtgactattttagagcgtgagctttac
aaaatgattacgaatcaagaacctaacttaactttagattcatttacttcggaattaaaa
gaaataaaagaaataattatagataagcatcaatcactttatgttacagaagtgaacagt
ttattaaataaagttcatctcttcggatttcattttgctaatctagatattcgtcaagat
agtagaaagcatgagcagtattttaacgatatggtaaacaccctaattgaaagcggtagc
actatattcccgaaaaactatcatgatttaccagaaaatgaacaagtgcaaattttatct
aaagttgaaggtgaagttgatttatctttaattaaagatgaagaaaccttgaaagcttta
aacacaatgaaagctataaaaaccattcaaaccacgaatggcgaagtagctgcaaaccgt
tatattattagtaacaaccaaacaacactgcatgttatgcaattgtttgctatgctaaaa
ctagtagcatttcaagataaattaacagttgatgttggacctttattcgaaactattacc
gatttagagaatgcacctcaagtcatggaagagctatatactaatccacaatatgctgca
cacttaaaatcaagaggaaacaagcaaactattatgcttggttttagtgatggaactaaa
gatggtggctatttaatggcaaattgggcaatctataaagccaaagaaaacctaactaca
atctcaagacaacacggtattactgttattttctttgatggtcgtggtggacctccagca
cgtggtggcggaaaaactcataatttctatgcctctcttggaccaacaattgaagataaa
gaagtacaattaacaatacaaggacaaacgattagttctaattttggaactttagattcg
tctcaatacaacttagagcaattaattagttctggtattcacaacagtttaagcgataaa
gatttgagcatgcttcctgaaaacagagcagtaatgaccgatttatctgagcgtagctac
gaagcttactctgcatttaaagcacacccaaaatttatttcgtatttagaacacatgagc
actttaaaatattatgcaaaaactaatattggaagccgcccatctaaacgaggaaaagca
gaaggtttagtattcgaagatttaagagccataccatttgttggctcttggagccagtta
aaacaaaatgtaccaggattttttggtgttggtacagcacttaagcattacgaagacact
aatacatttgaaaaagctcagaaattatttaaaacttcagacttctttaagacccttatt
gaaaatagtatgatgtctttatctaaatcatttttcgatttaacaaaatacatgagcgaa
gatgaagaatatggtggattttggaatgttatttatgaagaatacaaaacgtctaaacgc
ttacttttaaagcttactggatacacagaacttatgcaagaagaacctgcaggaagcgca
tctattgcagttagagaatctattgttttaccattattaacgatacaacaatttgcattg
aaaaaaattcaggaacttgaaaaagctgaagttagagatgatgctcagattgctatttat
gaaaaattagtaacgcgttcgttgtttggtaatattaatgctagtcgtaattccgcttaa

DBGET integrated database retrieval system