KEGG   Lacinutrix sp. Bg11-31: CW733_12300Help
Entry
CW733_12300       CDS       T05225                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
laci  Lacinutrix sp. Bg11-31
Pathway
laci00010  Glycolysis / Gluconeogenesis
laci00053  Ascorbate and aldarate metabolism
laci00071  Fatty acid degradation
laci00280  Valine, leucine and isoleucine degradation
laci00310  Lysine degradation
laci00330  Arginine and proline metabolism
laci00340  Histidine metabolism
laci00380  Tryptophan metabolism
laci00410  beta-Alanine metabolism
laci00561  Glycerolipid metabolism
laci00620  Pyruvate metabolism
laci00625  Chloroalkane and chloroalkene degradation
laci01100  Metabolic pathways
laci01110  Biosynthesis of secondary metabolites
laci01120  Microbial metabolism in diverse environments
laci01130  Biosynthesis of antibiotics
Module
laci_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:laci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CW733_12300
   00053 Ascorbate and aldarate metabolism
    CW733_12300
   00620 Pyruvate metabolism
    CW733_12300
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CW733_12300
   00561 Glycerolipid metabolism
    CW733_12300
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CW733_12300
   00310 Lysine degradation
    CW733_12300
   00330 Arginine and proline metabolism
    CW733_12300
   00340 Histidine metabolism
    CW733_12300
   00380 Tryptophan metabolism
    CW733_12300
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CW733_12300
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CW733_12300
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CW733_12300
Enzymes [BR:laci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CW733_12300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUC82861
UniProt: A0A2K8XIU0
LinkDB All DBs
Position
complement(2725165..2726715)
Genome map
AA seq 516 aa AA seqDB search
MAVSTDFGIKEALQKLGVKDVNDGTSTGLKNFGSGETISSYSPTDGSLIGKVTTTTKADY
EKVMDAATSAFLTFRTMPAPQRGEIVRQFGNKLRELKEPLGKLVSYEMGKSLQEGYGEVQ
EMIDICDFAVGLSRSLNGQTIPSERPQHVMREQWHSLGVVGIISAFNFPVAVWAWNTALA
WVCGDVCVWKGSEKAPLCSIACQNIIATVLKENNLPEGISCIINGDYKVGEMMTTDHRIP
LISATGSTRMGRIVGATVAERFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAVGTCGQ
RCTSTRRLIIHESVYDKVRDAIVGAYGQLTIGNPLDEKNHIGPLIDKDSVNTYLAAIEKA
KAEGGNVLVEGGVLEGEGYESGCYVKPAIIEAKNDFEIVQSETFAPVLYLIKYSGDVENA
IGVQNGVAQGLSSAIMTNELKEAEKFLSFAGSDCGIANVNIGTSGAEIGGAFGGEKETGG
GRESGSDAWKVYMRRQTNTVNYSDELPLAQGIKFDL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcagtttcaactgatttcggaataaaagaagccttacaaaaattaggtgttaaagat
gtaaatgatggaacttctacaggtttaaaaaactttggaagtggagaaacaatttcttca
tattcaccaacagatggttctttaataggaaaagtaacgacaactacaaaagcagattac
gagaaggtaatggatgcagcaacgtctgcatttttaacttttagaacaatgcctgcacct
caaagaggagagattgtacgtcagtttggtaataaattaagagaattaaaagagccttta
ggaaaattggtgtcttatgaaatgggaaaatctttgcaagaaggttatggtgaggttcaa
gagatgattgatatctgtgatttcgcagtaggtttatcacgttcattaaatgggcaaaca
attccatctgaaagaccacaacacgttatgagagaacaatggcactcactgggtgttgtt
ggtatcatttcagcatttaactttccagttgcagtttgggcttggaatacagctttagct
tgggtttgtggtgatgtttgtgtttggaaaggttcagaaaaagcacctttatgttcaatt
gcttgtcagaatataattgcgaccgttttaaaagaaaataacttaccagaaggtatttct
tgtattattaatggagactacaaagtaggtgaaatgatgactacagatcatagaattcca
ttaatatctgctacaggttctacaagaatgggacgtattgttggtgcaacagttgctgag
cgttttggaaaatctctattagagttaggtggaaataatgctataattattacaccaacc
gcagatttaaaagttgttgttcctggtgctgtatttggtgctgtaggaacttgtggtcaa
cgttgtacttcaacaagaagactaattattcacgaatcggtttacgataaagtaagagat
gctattgttggtgcttatgggcaattaacgattggtaatcctttagatgaaaaaaatcat
attggaccattaatagataaagattctgtaaatacatatttagctgcaattgaaaaagca
aaagctgaaggtggaaatgtattagtagaaggtggagttttagaaggtgaaggatacgaa
tctggatgttacgtaaaaccagctattatagaggctaaaaatgatttcgaaatcgtacag
tcggaaactttcgctcctgttttatatttaataaaatactcaggagacgttgaaaatgct
attggtgttcaaaacggagttgctcaaggtttatcttctgcaattatgactaacgaatta
aaagaagctgaaaagttcttgtcattcgctggttcagattgtggtattgcaaatgtaaat
attggaacttctggtgccgaaattggtggtgcttttggtggtgaaaaagaaactggtggt
ggacgcgagtctggatcagatgcttggaaagtttacatgagaagacaaacaaatacagta
aattattcagacgaattacctttagcgcaaggtattaagtttgatctataa

DBGET integrated database retrieval system