KEGG   Lacinutrix sp. Bg11-31: CW733_13260Help
Entry
CW733_13260       CDS       T05225                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
laci  Lacinutrix sp. Bg11-31
Pathway
laci00240  Pyrimidine metabolism
laci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laci00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CW733_13260
Enzymes [BR:laci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CW733_13260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AUC83042
UniProt: A0A2K8XJF2
LinkDB All DBs
Position
complement(2949530..2950171)
Genome map
AA seq 213 aa AA seqDB search
MFLENTVNQKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAIDVRYDDEM
VVSHDANQIRSTPVPAAANIPILADGCDVVGIDEAQFFDDEIVRVCNDLANKGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQFSYRKNKSEDLVLLGEIEEYEP
LSRAAYYKAITREKIKTMEVNDAEALKPKDKDA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaatcaaaaagaacaatttggttggattgaagttatttgc
ggttccatgttttctggaaaaaccgaagagcttattcgaagactaaaacgtgcacagttt
gcaaagcaaaaagtagaaatattcaagcctgcaatagatgtgcgatatgatgacgaaatg
gtagtctctcacgatgctaaccaaattcgctctactccagttcctgccgctgctaatatt
cctattttggcagatggttgcgatgtggttggtattgacgaagctcagtttttcgacgac
gaaattgtacgtgtttgtaacgatttagcaaacaaaggcattcgtgttattgttgctggg
ttagatatggattttaaaggcaatccatttggaccaatgcctaatttaatggcaactgca
gagtatgttaccaaagtacatgccgtttgtacacgtacaggaaatcttgcacaatttagt
taccgaaaaaataaaagtgaagatcttgtgttattaggcgaaattgaagaatacgaacct
ttaagtcgagcagcatactataaagcaatcacgcgagaaaaaataaaaacaatggaagtg
aatgatgccgaagcactaaaacctaaagataaagatgcttaa

DBGET integrated database retrieval system