KEGG   Lactococcus sp. 1JSPR-7: D7I46_03030Help
Entry
D7I46_03030       CDS       T05686                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lact  Lactococcus sp. 1JSPR-7
Pathway
lact00564  Glycerophospholipid metabolism
lact01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lact00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D7I46_03030
Enzymes [BR:lact01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D7I46_03030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 GIDA Pyr_redox_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AYG00145
UniProt: A0A387B8K4
LinkDB All DBs
Position
complement(616965..618542)
Genome map
AA seq 525 aa AA seqDB search
MPISREKNIETLKNHPEGWDFIIIGGGATGLGVAVDAASRGYKTVLLEQNDFAKSTSSRS
TKLVHGGVRYLAQGDIALVREALHERGRLARNAQHLVKSQKFIIANRKTWEQPFYSVGMK
FYDALAGKLNIGKSKIYSKKKVKEGIPKIKFDGLVGGVMYYDGQFDDARMAINLVQTATE
HGAVLVNYAGVTGLKKSNGKLSGVSVKDNFTGESFELNGKVVINASGIFVDQIMSMDIKN
HKPSVRPSQGVHLIVDGKFLGGDDAIMVPKTSDGRVLFCVPWHNKVILGTTDTPLTEFTL
EPRPLEEEIDFILQTAGEYLEQAPTRDDVLCAYAGLRPLAAPKEGADPSKTKEISRSHKL
FSNDSGLVTITGGKWTTYRQMAEETVDLGIKIGNLPVHDCITKTLTIHGSKTTTTQDRED
WIYVYGTDGEKIRQLEKENPDLAQPLSDKYEFTGGEVVWAVREEMAQKLEDVLARRVRVL
FLDARESKVIAPKVAHIMATELGYNKDWELEQVKDYNKLADGYIL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgccgatttctcgtgaaaaaaatatagaaactctcaaaaatcatcctgaaggatgggat
tttattatcataggtggaggagcaacaggactgggagttgccgttgatgctgcttctcgt
ggatataaaactgttctacttgaacaaaatgactttgcaaaatcaacttcaagtcggtca
acaaaactcgtccacggaggcgttcgctaccttgcacaaggcgatattgctcttgttcga
gaagcccttcatgaacgcggccgcctagcacgtaatgctcagcatcttgttaaaagtcaa
aaattcattatcgccaaccgaaaaacttgggaacaacctttttactccgttggtatgaag
ttctatgacgccttagctggaaaactcaatattggaaaatcaaaaatttattccaagaaa
aaagttaaagaagggattcctaaaatcaagtttgatggcttagttggcggtgtcatgtac
tatgatggacaatttgatgatgccagaatggcaataaatctcgtccaaaccgcgacagaa
catggtgctgttctagtcaactatgctggtgttacaggattaaaaaaatcaaacggaaaa
ctttcaggagtgtccgtcaaagataattttacaggtgaatcttttgagctaaatggaaaa
gttgtcatcaacgcttcaggcatcttcgttgaccaaattatgtctatggacatcaaaaat
cacaaaccctcggttcgtccatcccaaggagtccatttgattgtcgatggaaaatttttg
ggaggcgatgatgcgattatggttcctaaaacttcagatggccgcgttcttttctgtgtt
ccttggcacaataaggttatcttaggaacaacagacacgcctttaacagagtttactcta
gagcctcgtccacttgaagaggaaattgactttattcttcaaacagcaggtgaatatctt
gaacaagcaccaacccgtgatgatgtactctgtgcctatgcaggacttcgtccactcgct
gccccaaaagaaggtgctgatccttccaaaacaaaagaaatctcacgaagccataaacta
ttcagtaatgattctggtctcgtcactatcactggtggcaaatggacaacctatcgtcaa
atggcagaagaaactgttgatctagggataaaaattggaaatctgcctgttcatgactgt
atcacaaaaacactcactattcatggttcaaagacaacaacaacgcaagaccgtgaagac
tggatttacgtctatggaaccgacggtgaaaagattcgtcaacttgaaaaagagaatcca
gaccttgctcagccactctctgataaatatgagttcactggaggtgaggtcgtctgggca
gttcgcgaagaaatggcacaaaaacttgaagatgtcctcgctagacgtgttcgtgtttta
ttccttgatgcacgcgaatctaaagtaattgctccaaaggtcgctcatattatggcaaca
gagttaggatacaacaaagattgggaacttgaacaagtcaaagattataataaattagct
gatggatatattttataa

DBGET integrated database retrieval system