KEGG   Lactococcus sp. 1JSPR-7: D7I46_07465Help
Entry
D7I46_07465       CDS       T05686                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lact  Lactococcus sp. 1JSPR-7
Brite
KEGG Orthology (KO) [BR:lact00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lact01001]
    D7I46_07465 (pknB)
Enzymes [BR:lact01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     D7I46_07465 (pknB)
Protein kinases [BR:lact01001]
 Serine/threonine kinases: Other
  Bacterial family
   D7I46_07465 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA RIO1 Kinase-like Kdo APH Haspin_kinase ETRAMP FTA2 O-antigen_lig DUF4366 ArlS_N
Motif
Other DBs
NCBI-ProteinID: AYG00944
UniProt: A0A387BF97
LinkDB All DBs
Position
complement(1623137..1625011)
Genome map
AA seq 624 aa AA seqDB search
MIQIGKIFADRYRIIKEIGRGGMANVYQGEDTFLDNRKVAIKVLRSNFENDDIAIARFQR
EAFAMAELSHPNIVGISDVGEFENQQYIVMEFVDGLTLKQYINEHAPLSNEEAIEITTEI
LSAMEMAHSHGIIHRDLKPQNVLVSHNGTVKVTDFGIAKALSETSLTQTNTMFGSVHYLS
PEQARGSNATVQSDIYAIGIILFELLTGQIPFDGDSAVAIALKHFQENIPSIINLNQNVP
QALENVVIRATAKDISDRYANVEEMMNDLATSTSLDRRGEPKLVFSKDKDATKIMPANLI
NPYDTKPLIDKKEGEDSEKNIEEAAAAKKKKSKKGIIATIIILLLVIGGSAAAWVALTPE
NVRVPDVKNMTLKEAEAKIKSAKLKVGTVRHESSSSIAQDKVTRTDPMAKTLVRTNSKIN
IYVSEGGNSFKMKNYVGKQYQDALDDLMINYNVSESQVVSKNVQSSQPAGTILKQTPAKG
DYFNLDGNKQIEFEVSEGEQGTMPEFKNRTWKQVKADLISMGVPEGNIILDQQPNTDYAN
GENYVYASNLDAGESFNIATQQITLTYLGPYQPASSVSTTSESSSSTSESAKDSSSSSAD
GNDSSNGNQQEAPKNSTTESSSSN
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatcggcaaaatctttgcggaccgttatcggattatcaaagaaatcggtcgt
ggtggtatggccaacgtgtatcaaggagaggatacttttcttgataaccgtaaggtagcc
ataaaagttttacgttccaattttgaaaatgacgatattgctattgctcgatttcaacgt
gaagcctttgcgatggctgaactttctcaccctaatattgtcggaatttctgatgtcggt
gaatttgaaaatcaacaatatatcgttatggaatttgttgatggtctgacacttaaacaa
tatatcaatgaacacgcaccattatcaaacgaagaagcgattgaaatcactacagaaatt
ttgtcagcgatggaaatggcacactcacatggtattatccatcgtgacttgaaacctcaa
aatgtattggtttcacacaatgggacagtcaaagtcacagactttgggattgccaaagct
ttatcagaaacatcattgacacagaccaataccatgtttggttcggttcattatttatca
ccagagcaggcgcgtggttcaaatgcaacggttcaatcagatatttatgcgattgggatt
atcttatttgagctgttgacagggcaaattccatttgatggagactctgctgttgctatt
gcgctgaaacatttccaagagaatattccaagcatcattaatctcaatcaaaatgttcct
caagctcttgaaaatgttgttattcgtgcgactgcaaaggacatttctgaccgatatgcg
aatgttgaggaaatgatgaatgacttggctacgtctacaagtttagaccgacgtggggag
ccaaaacttgtctttagtaaagacaaagatgcaacgaagattatgccagcaaacttgata
aatccttatgacacaaagcctttaattgacaaaaaagagggtgaagattctgagaaaaat
atcgaggaagcggcggctgcaaagaaaaagaaatctaaaaaaggaatcattgcaacgatt
atcattttattgttggtcattggtggttccgctgctgcgtgggttgctttgactcctgag
aatgtgagagtacctgatgtaaaaaatatgaccttaaaagaggcagaagcaaaaataaag
agtgctaaacttaaagttggaacagttcgacatgagtccagctcttccattgctcaagat
aaagttactcggacagaccctatggcaaaaacgttagtacgaacaaatagtaaaattaat
atctatgtttcagaaggcggaaattccttcaagatgaagaattatgttgggaaacaatat
caagatgctttagatgatttgatgattaattataatgtgtcagagagtcaagtggtttct
aagaatgttcagagttctcaaccagcaggaacaattttgaaacaaacgcctgcaaaaggg
gattatttcaatctcgatggtaataagcagattgagtttgaagtttcagaaggtgagcaa
ggaacaatgcctgagtttaaaaacaggacttggaaacaagtgaaggcagatttgatttcg
atgggtgtaccagaaggaaacattattttggatcaacagccaaacacggattatgctaat
ggtgagaactacgtttatgcttcaaatcttgacgcaggtgagtctttcaatattgcaaca
caacaaattacgctaacttatttaggcccttatcaaccggcttcaagcgtatcaacaaca
agtgaaagttcatctagtacatcggaatcggcaaaagattcaagttcgtcttcagccgat
gggaatgattcatcaaatggtaatcagcaagaagctccaaaaaattctactacggagtcc
tcatccagtaattaa

DBGET integrated database retrieval system