KEGG   Lactococcus sp. 1JSPR-7: D7I46_10835Help
Entry
D7I46_10835       CDS       T05686                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
lact  Lactococcus sp. 1JSPR-7
Pathway
lact00220  Arginine biosynthesis
lact00250  Alanine, aspartate and glutamate metabolism
lact00290  Valine, leucine and isoleucine biosynthesis
lact01100  Metabolic pathways
lact01110  Biosynthesis of secondary metabolites
lact01130  Biosynthesis of antibiotics
lact01210  2-Oxocarboxylic acid metabolism
lact01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lact00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D7I46_10835
   00290 Valine, leucine and isoleucine biosynthesis
    D7I46_10835
   00220 Arginine biosynthesis
    D7I46_10835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lact01007]
    D7I46_10835
Enzymes [BR:lact01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     D7I46_10835
    2.6.1.66  valine---pyruvate transaminase
     D7I46_10835
Amino acid related enzymes [BR:lact01007]
 Aminotransferase (transaminase)
  Class I
   D7I46_10835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AYG01513
UniProt: A0A387BCI0
LinkDB All DBs
Position
2281691..2282905
Genome map
AA seq 404 aa AA seqDB search
MKEFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVIRDLIQ
NAVESEGYSDSKGIFSARKAIMQYCQIKGFPNVDVDDIYTGNGVSELIVMSMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGKAVHYVCDEQAGWFPDIDDIKSKITNNTKAIVLINPNNP
TGALYSKELLLEIVQIAREHDLIIFSDEIYDRLVMDGATHVPIASLAPDVFVVTMNGLSK
SHRIAGFRVGWMVLSGDKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRIYEQREFIYNAINAIPGLSAVKPQAAFYIFPKIDREMYRIDNDEQFVLDFLKQEK
ILLVHGRGFNWNQPDHFRIVYLPRVDELAEIQEKMERFLHQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagttcgaaaaatcacataagttagataatgttagctacgatattcgtggccca
gtacttgatgaggcacagagaatgcgagccaatggtgaaaaaatcttgcgtctaaatacg
ggaaatcccgcagaatttggttttttggcacctgatgaggtgattcgtgatttaattcaa
aacgcagtggagagtgagggttactctgactcaaaaggaattttttctgcgcgtaaagct
attatgcagtattgtcagattaaaggctttccaaatgttgatgttgatgatatttatacg
ggaaatggtgtttctgaactcattgtaatgagtatgcaaggtttgcttgacacaggtgat
gaagtgcttattcctatgcctgattatccactttggacagcatcggttagcttagctggt
ggtaaagctgtgcattatgtatgtgatgagcaggcaggctggttcccagatattgatgat
attaaatcaaaaatcacaaacaatacaaaagcgattgtcctaatcaatcccaataatccg
acaggcgcgctttattctaaagaattattactagaaattgtgcagattgctcgtgaacat
gatttgattatcttttctgatgaaatctacgaccgattagtgatggatggtgctactcat
gtgccgattgcaagtcttgctccagatgttttcgtggtcacaatgaatggtctttcaaaa
tcccatcgaattgcaggtttccgtgtgggctggatggttttatcaggtgataaatctcat
gttaagggttatattgaagggctgaatatgcttgcttcaatgcgactttgttcaaatgtt
ttggcacagtctgttgttcagacttcactcggaggcactcagtctgttgataagttactt
ttacctggtggacgtatttatgaacagcgtgaatttatttataacgctatcaatgctatt
cctggactatcggcagtcaagccacaagctgcattctatatcttcccaaagattgaccgt
gaaatgtaccgaattgacaatgacgaacagtttgtactagattttttgaaacaagagaaa
attttgttagtacacgggcgaggcttcaactggaatcaaccagaccatttccggattgtt
tatttgcctagagttgatgaactggcagaaattcaagaaaaaatggaacgttttttgcac
caatatagaagatga

DBGET integrated database retrieval system