KEGG   Lachnoclostridium sp. YL32: A4V08_09195Help
Entry
A4V08_09195       CDS       T04430                                 

Definition
(GenBank) glutaminyl-tRNA synthase (glutamine-hydrolyzing) subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
lacy00970  Aminoacyl-tRNA biosynthesis
lacy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lacy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A4V08_09195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lacy03029]
    A4V08_09195
Enzymes [BR:lacy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A4V08_09195
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A4V08_09195
Mitochondrial biogenesis [BR:lacy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A4V08_09195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ANU45966
UniProt: A0A1C7G2F1
LinkDB All DBs
Position
complement(2067027..2068475)
Genome map
AA seq 482 aa AA seqDB search
MSKQYETVIGLEVHVELATKTKIFCGCSTRFGGAPNTHTCPVCTGMPGSLPVLNKQVVEY
ALAVGLAANCQINQYCKFDRKNYFYPDNPQNYQISQLYLPVCHDGWVDIETESGLKKRVG
IHEIHMEEDAGKLIHDEWEDCSLVDYNRSGVPLIEIVSEPDMRSAEEVIACLEKLRLIIQ
YLGASDCKLQEGSMRADVNLSVREAGAAEFGTRTEMKNLNSFKAIARAIEGERRRQIELL
EDGRKVIQETRRWDDNKESSKAMRSKEDARDYRYFPDPDLVPVVISDEWIARVKARQPEL
RTEKIARYMEEYGLPEYDARLLTSSKHMADIFEETTRLSGQPKEASNWLMVEAMRLMKEQ
EMEPEDMRFSPTHLAALIGMVEKNTINRTVAKTVFEEIFRHDADPEAYVEEKGLKVIRDE
GALRRTVEAVMAANPQSVEDYRSGKEKAMGFLVGQTMKAMKGKADPAMVNQLVRELLAGG
DA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacagtatgagaccgtcatcgggctggaagtccatgtggagctggccaccaaa
accaagattttctgcggctgttccacccggttcgggggagcgccaaacacccatacctgc
cccgtatgcaccggtatgccgggttcccttcccgtgttaaataagcaggtggtggagtat
gcgctggcagtgggactggctgccaactgccagattaaccagtactgtaaatttgacaga
aagaactatttttatccggataatccgcagaactaccagatatcccagctgtacctgcct
gtctgccacgacggctgggtggacatagagactgagtccggccttaagaaacgcgtggga
atccatgaaatccacatggaggaggatgcgggcaagctgattcatgatgagtgggaggac
tgttccctggtggattataaccgcagcggagtcccgctgattgaaattgtgtcggagcct
gatatgcgcagtgctgaggaagtcatagcctgcctggagaagctgaggctgataatccag
tacctgggcgcttctgactgcaagcttcaggagggatccatgagagcggacgtgaacctg
tccgtgagagaggcgggggcggctgagtttggcaccaggaccgagatgaagaacctaaac
tcctttaaggccattgccagggccatagaaggggagcgcaggcgccagattgagctgttg
gaagacggcaggaaggtaatccaggagacacggcgctgggacgacaacaaggagagctcc
aaggccatgcggtccaaggaggatgcccgggattacaggtatttccctgatccggatctg
gtgccggtggtcataagcgatgagtggattgcccgggtaaaggcccgccagccggagctg
cgcacggagaaaatagccagatacatggaggaatacggtcttcctgagtatgacgccagg
cttctcaccagttccaagcacatggcggatatctttgaggagaccacgcgtttgagcgga
cagcccaaggaggcctccaactggctcatggtggaggccatgcgcctgatgaaggagcag
gaaatggagccggaggacatgagattctcccccacccatctggctgcccttatcggcatg
gtggagaaaaacaccatcaacaggacggtggccaaaaccgtgtttgaagagatattcagg
cacgacgcggatcctgaggcgtatgtggaggaaaagggcctcaaggtgataagggatgaa
ggcgccctgcgccgcaccgttgaggcggtcatggctgccaacccgcagtccgtggaggat
tacaggagcggcaaggaaaaggccatgggattcctggtgggacagaccatgaaggccatg
aagggcaaggcagatccggccatggtgaaccagcttgtaagggagctgcttgccggcggg
gatgcataa

DBGET integrated database retrieval system