KEGG   Lachnoclostridium sp. YL32: A4V08_13405Help
Entry
A4V08_13405       CDS       T04430                                 

Definition
(GenBank) peptide ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
lacy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lacy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A4V08_13405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lacy02000]
    A4V08_13405
Transporters [BR:lacy02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    A4V08_13405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_22 RsgA_GTPase ABC_ATPase
Motif
Other DBs
NCBI-ProteinID: ANU46651
UniProt: A0A1C7G3J9
LinkDB All DBs
Position
complement(2946882..2947862)
Genome map
AA seq 326 aa AA seqDB search
MSHILEVTNLEVEFSGDGGKNISVDHVGFHVDSGEIVCIVGESGCGKSVTSLSVMGLLGK
GGKVTDGQILFEGRDLLSMTERELDGVRGDRLTMIFQDPLTSLNPVFTIGSQMTESIRAH
MGLGKDEARERALSLLKKVGLPDTLSVMKKYPHLLSGGMRQRVMIAMALSCNPSLLIADE
PTTALDVTIQAQIMDLILELKEEMGMAVLLITHDMGLVAQMADRVLVMYAGQLIEQARVL
ELFDHPAHPYTRALLRSVPGIRDEENRRLESIEGIVPEHYDRIRGCRFARRCPFRTAMCM
KPQQEVPVGDSHIVRCCRAKEVLADG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatatccttgaagtcacgaatctggaagttgaattttctggtgacggggggaag
aatataagtgtggaccacgtgggattccatgtggattcgggggagatagtctgtatagta
ggggagtcgggctgcggcaaaagcgttacctccctgtctgttatggggcttttaggcaaa
ggggggaaggtgactgacggccagatcctgttcgagggaagggatttgctctccatgaca
gagagggagctggacggagtcaggggagaccggctgaccatgatattccaggacccactt
acctcccttaaccctgtatttaccatcgggagccagatgacggagagcatccgcgcccat
atggggctgggaaaggatgaggcccgggagagggcattgtccctccttaagaaggtgggg
ctgccggacaccctctctgtgatgaaaaaatacccgcacctgctgtcaggaggcatgcgc
cagcgtgtcatgattgcaatggccctttcctgcaatccgtcccttctgattgccgacgag
cctaccacggctctggatgtgacgattcaggcccaaatcatggacctgattctggagctt
aaggaggagatgggcatggcggtgctgctcatcacccatgacatgggattggtggctcag
atggctgaccgggtgctggtaatgtatgcgggacagctcatagagcaggccagggtgctg
gagctgtttgaccatccggcccatccctacaccagggccctgctgcgttccgtacccggt
atcagggatgaggagaacagaaggctggagtccatagagggaattgtgccggaacactac
gacaggattcggggatgccgttttgcaaggagatgccccttcaggacagcgatgtgcatg
aagccgcagcaggaggtgcctgtaggggattcccatattgtgcggtgctgcagggcgaag
gaggtgctggcagatggctga

DBGET integrated database retrieval system