KEGG   Lachnoclostridium sp. YL32: A4V08_25530Help
Entry
A4V08_25530       CDS       T04430                                 

Definition
(GenBank) restriction endonuclease
Organism
lacy  Lachnoclostridium sp. YL32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII
Motif
Other DBs
NCBI-ProteinID: ANU48669
UniProt: A0A1C7G914
LinkDB All DBs
Position
5365944..5366807
Genome map
AA seq 287 aa AA seqDB search
MVRRDFDAWLSKFRASISGYRYYIDFEKVVRNVEDIKIKLNILNSLIGSVNIEDDFEKII
TKYPETLSCIPLLLAVRSNEIYAQDEDGAFEYHFKTMNYDMDQYKIFMRKTGLFDLLQKH
LVNNLVDYALGIETGLDSNGRKNRGGHQMEELVEKYIIAAGFTKDESYFKEMYLKDIEDK
WDIDLSALSNEGKAAKRFDFVVKTESMIYAVETNFYSGGGSKLNETARSYKMLSQEADTI
EGFSFVWFTDGIGWKSAKGNLRETFEAMEHVYNIDDMEHSVMTELLV
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagaagagattttgacgcatggcttagtaaattccgggcaagcatttcagggtac
cggtattacatagattttgaaaaggtagtccgcaatgtggaggatataaaaatcaagtta
aacatactaaattcactgataggttctgtgaatatagaagatgattttgaaaaaataata
acaaaatatccggaaaccctgtcctgcattcccctgcttctggcagtgcggagcaatgaa
atatatgcccaggatgaggacggcgcatttgagtatcattttaaaacaatgaattatgat
atggatcaatataagatatttatgagaaaaacaggattgtttgacttattgcagaagcat
ctggtaaataatctggttgattatgcgctggggattgagacaggacttgattccaatggc
cgcaagaaccgcggcgggcaccagatggaagagctggtggagaaatatatcattgccgcg
ggatttactaaggatgagagctactttaaagagatgtatcttaaggatattgaggataaa
tgggatattgatttatccgccctgtccaacgaaggcaaggcggcaaagcggtttgacttc
gtggtaaaaacagagtccatgatttatgcggttgaaacgaatttttacagcggcggcggc
tcgaagctgaatgaaacggccagaagctataagatgctttcccaggaggcagacacaatc
gaaggattttcttttgtgtggtttacggatgggattggctggaaaagcgcgaaagggaat
ctgcgggaaacctttgaagcaatggagcatgtttacaatattgacgatatggagcattcg
gttatgactgagcttctggtgtga

DBGET integrated database retrieval system