KEGG   Lactobacillus acidophilus La-14: LA14_0731Help
Entry
LA14_0731         CDS       T02647                                 

Definition
(GenBank) Uracil-DNA glycosylase, family 1
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
lad  Lactobacillus acidophilus La-14
Pathway
lad03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lad00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LA14_0731
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lad03400]
    LA14_0731
Enzymes [BR:lad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     LA14_0731
DNA repair and recombination proteins [BR:lad03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LA14_0731
 Prokaryotic type
     LA14_0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AGK93903
LinkDB All DBs
Position
697865..698563
Genome map
AA seq 232 aa AA seqDB search
MAKELIGNDWDQILNPIFTSDKYHELHNFLKKEYSTRQIYPDMYHIFTAFKLTPFNKTKV
VILGQDPYHNPGQANGMSFSVMPGAQLPPSLRNIYKELYDDVGAIPVNHGYLKKWADQGV
LLLNAVLTVPYGHANGHQGKGWEDVTDAAIKALSKRGKVVFILWGRFAQNKIPLIDQSKN
FIIKSSHPSPFSADRGFFGSRPFSRCNTALINFGETPIDWQLPEKVSKSDLI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaaagaattaatcggtaatgattgggatcaaatattaaatccgatctttacaagt
gataaatatcacgaacttcataattttttaaaaaaagaatattcaacaaggcaaatttat
ccggatatgtatcatatttttactgcttttaaactaacgccatttaataaaacaaaggta
gtaattttaggacaagatccatatcataatcccgggcaagctaatggtatgagtttctct
gttatgccaggtgctcaattaccgccgtcacttagaaatatttataaagagctttatgat
gatgtgggagctatcccagtaaatcatggctatctgaagaaatgggctgatcaaggtgta
ttattactaaatgcagtattaacggttccatatggtcatgcaaatggacatcaaggcaag
ggttgggaagacgtaaccgatgcggcaattaaagcgcttagtaagcgaggcaaggtagtc
tttattttatggggacgatttgctcagaataaaattccattaattgatcaaagcaagaac
tttattataaaatcatctcatccgagtcctttttcagccgatcgtggattttttggttca
agaccattttctcgttgcaatacggcattaattaattttggcgagactccaattgattgg
caacttccagaaaaggtaagtaaatctgatttaatataa

DBGET integrated database retrieval system