KEGG   Lactobacillus acidophilus La-14: LA14_1592Help
Entry
LA14_1592         CDS       T02647                                 

Definition
(GenBank) NAD(P)HX dehydratase
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
lad  Lactobacillus acidophilus La-14
Brite
KEGG Orthology (KO) [BR:lad00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LA14_1592
Enzymes [BR:lad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     LA14_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AGK94754
LinkDB All DBs
Position
complement(1595080..1595928)
Genome map
AA seq 282 aa AA seqDB search
MTELTEDILKKVIKKRSSNTHKGNYGRILLIGGSENYGGAIIMSTEAAVNSGAGLTAVAT
HHLNLSALHSRIPEAMFIDWHDAKLADLIKNMDVVVCGSGLGMSDFAKQILVILRRCTSE
KQTVILDASALDLISEDKSLLPVNAGHLILTPHQMEWQRLSQIRIPFQTDSANIDALKQL
IPDSNAVLVLKSNHTHIYDGTGRTFVNPIGNPGMATGGMGDTLAGIIGGFVAQFGPSVDT
ISAAVYIHSLAGDLINKDNYVVKPTEVSKVLPKLMKKYSELE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacagaactaactgaagatatactaaaaaaagttattaaaaaaagatctagtaatact
cataaaggtaattatggccgcattcttttaattggtggcagtgaaaattacggtggtgca
attatcatgtcaaccgaagcagcggttaatagtggtgcaggtttaacagctgtggcaact
catcatcttaatttgtcagctcttcattcacgtataccggaagccatgtttattgattgg
catgatgctaaactagcagatttgattaaaaatatggatgtagtggtttgtggatcaggc
ctagggatgtcagattttgctaagcaaattttagtaattttaagaagatgtacttcagaa
aagcaaaccgtcattttagatgctagtgcgcttgatttaattagtgaggataaaagctta
ttaccagttaatgctggacatttgattttgacacctcaccaaatggaatggcaacgactt
agtcaaattcgtattccattccaaacagatagtgctaatattgatgcattgaagcagtta
attcctgatagtaatgcagttttagtcttaaagtctaatcatactcatatttatgacggt
actggtcgcacttttgttaatccgataggtaatccaggtatggctactggtggtatgggt
gatacattggctgggataattggtggctttgtcgctcaatttggccccagtgttgataca
atttcggctgctgtttatattcattctttagcaggagatttaattaataaggataactat
gtagttaagccaaccgaagtttctaaagtattacctaaattaatgaaaaagtattcagaa
cttgaataa

DBGET integrated database retrieval system