KEGG   Lactobacillus acetotolerans: LBAT_0156Help
Entry
LBAT_0156         CDS       T03976                                 

Definition
(GenBank) D-alanyl-alanine synthase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lae  Lactobacillus acetotolerans
Pathway
lae00473  D-Alanine metabolism
lae00550  Peptidoglycan biosynthesis
lae01100  Metabolic pathways
lae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LBAT_0156
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LBAT_0156
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LBAT_0156
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lae01011]
    LBAT_0156
Enzymes [BR:lae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LBAT_0156
Peptidoglycan biosynthesis and degradation proteins [BR:lae01011]
 Precursor biosynthesis
  Amino acid ligase
   LBAT_0156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 GARS_A CPSase_L_D2 RimK GARS_N
Motif
Other DBs
NCBI-ProteinID: BAQ56545
UniProt: A0A0D6A1Y0
LinkDB All DBs
Position
152363..153448
Genome map
AA seq 361 aa AA seqDB search
MTKKTQVGLIFGGNSSEYRVSIMSGHNIYKAIDKDKFTVHPIWITNDGYFADEDESLKVL
KNPSYQVKNPHKVTNISNLIELTNLPEIDIFFPIVHGNLGEDGSLQGLFRVLNKPFVGDD
VLAAAVTMDKEFTKILAQRAGIPVADWISVKRYEYNDKNNDKLNYNKVSQKLGKDLFVKP
SNQGSSVGVNHVTNAEDYKAALDDAFKYDDKVLVEKTIHGTEVETAVLGNDKPIVSGVGQ
IINAKGTFYTYKNKYEDNSTSKLQIPADLPADVVKKVRSNALKVYQATECSGIARVDSTL
QDGDNKVVLTEVNALPGFTNISMYPKLFEQAGISYIDLITRLIEAGQERFDHKKTLLHKL
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaacgcaagtaggattaatttttggtggaaattcatctgaatatagagta
tccattatgtcgggccataatatttataaggcaattgataaggataaatttacggttcac
ccaatttggattactaatgacggttactttgctgatgaagatgagtcactcaaagtatta
aagaatccatcataccaagttaagaatccgcataaggtaactaatatttctaacttaatt
gaattaactaacttaccagaaattgatattttcttcccaattgttcatggtaacttaggt
gaagacggcagcttgcaaggtttgtttagggttttgaataaaccgtttgtcggggatgac
gttttagcagcagccgtaacaatggataaggagtttaccaagattttagcacaacgtgcc
ggtattcctgtagctgattggatctccgttaagcgttatgaatataatgataagaataat
gataaattgaattataataaggttagccaaaaattaggtaaggacttgtttgtcaagcct
tctaatcaaggctcatcagttggtgttaaccatgtgactaacgctgaagactacaaagcg
gctttagatgatgcctttaaatatgatgataaagttttagtagaaaaaacaattcatggt
accgaagttgaaactgctgttttaggtaatgacaaaccgattgtatccggagttggacaa
attattaatgctaaggggactttttatacttataaaaataagtatgaagataactctact
tctaagttgcaaatcccagctgatttaccagctgatgttgttaaaaaagtcagatcgaat
gcgttgaaagtttatcaggctactgaatgcagtgggatagcccgggtcgattccaccctg
caagatggtgacaacaaagtggttttaaccgaagtaaatgctttacccggttttactaat
attagtatgtatccaaaattgtttgagcaagcgggaatttcttacattgacttaattacc
cgtttaattgaagccggtcaagagcgttttgatcataaaaagactttgttacataagctt
ggatag

DBGET integrated database retrieval system