KEGG   Lactobacillus acidophilus FSI4: SD55_0337Help
Entry
SD55_0337         CDS       T03681                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
laf  Lactobacillus acidophilus FSI4
Pathway
laf00010  Glycolysis / Gluconeogenesis
laf00260  Glycine, serine and threonine metabolism
laf00680  Methane metabolism
laf01100  Metabolic pathways
laf01110  Biosynthesis of secondary metabolites
laf01120  Microbial metabolism in diverse environments
laf01130  Biosynthesis of antibiotics
laf01200  Carbon metabolism
laf01230  Biosynthesis of amino acids
Module
laf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:laf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SD55_0337
  09102 Energy metabolism
   00680 Methane metabolism
    SD55_0337
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SD55_0337
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:laf04131]
    SD55_0337
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:laf04147]
    SD55_0337
Enzymes [BR:laf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SD55_0337
Membrane trafficking [BR:laf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SD55_0337
Exosome [BR:laf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SD55_0337
  Exosomal proteins of melanoma cells
   SD55_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sec31
Motif
Other DBs
NCBI-ProteinID: AJP45805
LinkDB All DBs
Position
322743..323420
Genome map
AA seq 225 aa AA seqDB search
MAKLVLVRHGESVANAENVYTGWNDVPLTEKGKQQAKKAGKLINTITDFAPTHIHTSVLS
RAIVTANIVADTCGLLWLPMTKTWRLNERHYGALRGLNKDVSRKVFGVEQVLLWRRGFNS
IPPAQGSPVIDRRYKLCDQHLMPRAESLHQTQNRLMPYYYDHIAPKLLNGEDQLIVAHGS
SLRALIKKLENINDHDIVNLEVPNAEPIVYTMDDQLNIINKKILR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
attgcaaagttagtattagttagacatggtgaaagtgttgcgaatgctgaaaatgtttat
acaggatggaatgatgttccattaactgaaaagggaaagcaacaagcaaaaaaagcagga
aaattaattaatactattactgattttgcaccaactcatattcatacatctgttttatca
agggctattgttactgctaatatagtagctgatacatgtggtttattatggttacctatg
actaagacatggagactaaatgaacgccactatggtgctttaagaggccttaataaagat
gtttcacgtaaggtgtttggtgtagaacaagttttattatggcgtagaggttttaattcg
attcctccggcacaaggatcaccagtaattgatcgtcgttataaattatgtgaccagcac
ttgatgccaagagcagaaagtttacatcaaactcaaaatagattaatgccatattactat
gatcatattgctcctaaattactcaatggcgaagatcaattaattgttgcacatggttct
agtttaagagctttaattaaaaaactcgaaaatattaacgatcatgatattgttaatcta
gaagtccctaatgcagagccaattgtttatactatggatgatcaattgaatattataaat
aaaaaaattttacgttaa

DBGET integrated database retrieval system