KEGG   Lactobacillus acidophilus FSI4: SD55_0766Help
Entry
SD55_0766         CDS       T03681                                 

Definition
(GenBank) histidine kinase
Organism
laf  Lactobacillus acidophilus FSI4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_3 MAPEG LolB
Motif
Other DBs
NCBI-ProteinID: AJP46172
UniProt: A0A3A9Y859
LinkDB All DBs
Position
733634..735085
Genome map
AA seq 483 aa AA seqDB search
MKLIYQNMLGFLLIIVTTISIIGYSEIGYARDQAYMQNYQRMEGYANSLGNLAAAEGKDD
TAILSNSFLNQLEFILRGDDVHLRIFNEKNEQIYPKTREKIQLSKNIFATLKNGQEIRIQ
NNHNENAPIASTKDAYTGVLVPWMNGKNLIGVAWISSRVKHVERPIYMAKRNLLRALLTT
VAVGLILSFIISYYSTKRIKRLSRATQKVASGNFNVQIKHKDSDEIDQLAENFNQMVLAL
KRSNEEVKAQENRRDQFMADAAHEMRTPLTTINGILEGLQYDAIPEESKPKSIALMQRET
KRLIRLVNENLDYEKIRNNQINLIKTNFNATPVLLDLKSQLMQNAKKAGDKLIFEVPTDL
PIYANRDRFTQVMVNLVQNAIQFTHDGKIKVSGKRLKHGAEFSVKDNGIGMSDDQIKYIF
ERFFKADPSRARMGTGESGLGLAIVSSLIKQHGGKITVDSKPGQGATFTVTFYDKGYEQF
IEK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaatttaccaaaatatgctagggtttctattaattattgtaactacaatttca
attattggatattccgagataggctatgcacgtgatcaagcatatatgcaaaattatcaa
agaatggaaggttatgctaattctttaggaaatttagcagcagctgagggaaaagacgat
acagcaatattaagcaatagctttttaaatcagttagaatttattcttcgcggggatgat
gttcatttacgaatttttaatgaaaaaaatgagcaaatttatcctaagactagagaaaaa
atacaattatctaaaaatatttttgctactttaaaaaatggtcaagagattcgtattcaa
aataatcacaatgaaaatgcgccaattgcatcaactaaggatgcctatacaggtgtttta
gttccttggatgaatgggaaaaatttaattggtgtagcgtggataagttccagagttaag
catgttgaaagaccgatatatatggccaaacgcaatttgcttagagcgttgttgactaca
gttgcagttggtttgattctgagttttattatttcatattactctactaaacgaattaaa
cgtttatcacgcgctacgcaaaaagtagcttcaggtaactttaatgtgcagatcaaacat
aaagatagcgatgaaattgatcagttagctgaaaactttaatcaaatggtattagcatta
aagcgatccaatgaagaagtcaaggcgcaagaaaatcggcgggaccaatttatggcagat
gctgctcatgaaatgagaacaccattaactactattaatggaattctcgaaggattacaa
tatgatgcaattccagaagaatctaaacctaaatcgatagcattgatgcagagagaaact
aaacgattaattagattagttaatgaaaatttggattatgaaaaaattcgtaataatcaa
atcaatttaattaaaactaattttaatgctacgccggtattattagacttaaaatcgcaa
ttaatgcagaatgctaaaaaagctggcgataagttgatttttgaagtaccgactgatcta
ccaatttatgcgaatcgtgatcgtttcactcaagtaatggtcaatttggtacaaaatgca
attcaatttactcatgatggtaaaattaaagtctctggtaaaagattaaagcatggagct
gaatttagtgttaaagataatggtattggtatgagtgacgatcaaattaaatatattttt
gagcgtttctttaaagctgatccatcccgtgcgcgaatgggaacaggtgaatcaggacta
ggacttgctatcgtatcttcgttgattaagcagcatggtggtaagataaccgttgattct
aagcctggtcaaggagctacatttacggtaactttttatgataaaggttatgaacaattt
attgaaaaatag

DBGET integrated database retrieval system