KEGG   Lactobacillus acidophilus FSI4: SD55_1874Help
Entry
SD55_1874         CDS       T03681                                 

Gene name
cobQ
Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
laf  Lactobacillus acidophilus FSI4
Pathway
laf00550  Peptidoglycan biosynthesis
laf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SD55_1874 (cobQ)
Enzymes [BR:laf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     SD55_1874 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 GATase DJ-1_PfpI Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AJP47162
UniProt: A0A3A9XW44
LinkDB All DBs
Position
1893958..1894644
Genome map
AA seq 228 aa AA seqDB search
MSDKLIKIAYLYEDLMNTYGDSGDVKILSFLLKREGYDTQVDNISLGDEFNAFDYDFVFF
GGGQDFEQTVVAKDLPRHKETLEKYINDDKPMLCICGGYQLMGSYYKTNSGVTIPGLDIL
PLHTVFKSDKRMIGDTRYMTEWGEVKAFENHSGQTYFDDTDKLHPLGNMIEGYGNNPQDH
VEGLRYRNFIGSYSHGPLLKNTNVANAIMKMIIAWHNERTNKPATVTE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaattaatcaaaattgcatatctttacgaagatttgatgaacacctacggc
gattctggcgatgttaaaatccttagtttcttacttaaacgtgaaggatacgacacacaa
gtggataacatttcacttggtgatgaatttaacgcttttgactacgacttcgtattcttt
ggtggtggccaagactttgaacaaactgttgttgctaaagatttaccaagacataaagaa
acacttgaaaaatatattaatgatgacaaacctatgctctgcatttgtggtggttaccaa
cttatgggcagttactacaagacaaattctggcgtaactatcccaggactcgatattttg
ccattacataccgtcttcaagtccgacaagagaatgatcggtgatacacgttacatgacc
gaatggggcgaagttaaggcatttgaaaaccactccggtcaaacttatttcgacgataca
gacaagttgcatccccttggcaacatgattgaaggttacggtaacaacccacaagaccac
gttgaaggcttgcgttaccgtaattttatcggatcatactcacatggtccacttctaaaa
aatactaacgtagctaatgcaatcatgaaaatgattatcgcttggcacaatgaaagaacg
aataaacctgctacagtaaccgaataa

DBGET integrated database retrieval system