KEGG   Vibrio anguillarum M3: N175_01205Help
Entry
N175_01205        CDS       T02823                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
lag  Vibrio anguillarum M3
Pathway
lag00071  Fatty acid degradation
lag00280  Valine, leucine and isoleucine degradation
lag00281  Geraniol degradation
lag00310  Lysine degradation
lag00362  Benzoate degradation
lag00380  Tryptophan metabolism
lag00410  beta-Alanine metabolism
lag00640  Propanoate metabolism
lag00650  Butanoate metabolism
lag00903  Limonene and pinene degradation
lag00930  Caprolactam degradation
lag01100  Metabolic pathways
lag01110  Biosynthesis of secondary metabolites
lag01120  Microbial metabolism in diverse environments
lag01130  Biosynthesis of antibiotics
lag01200  Carbon metabolism
lag01212  Fatty acid metabolism
Module
lag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:lag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    N175_01205 (fadB)
   00650 Butanoate metabolism
    N175_01205 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    N175_01205 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N175_01205 (fadB)
   00310 Lysine degradation
    N175_01205 (fadB)
   00380 Tryptophan metabolism
    N175_01205 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    N175_01205 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    N175_01205 (fadB)
   00281 Geraniol degradation
    N175_01205 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N175_01205 (fadB)
   00930 Caprolactam degradation
    N175_01205 (fadB)
Enzymes [BR:lag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     N175_01205 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     N175_01205 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     N175_01205 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     N175_01205 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AGU56504
LinkDB All DBs
Position
1:complement(243356..245527)
Genome map
AA seq 723 aa AA seqDB search
MIYQANTLQVKELQDGIAELRFCSKESVNKLDLATLESLNHALDALKAHQGLKGLILTSD
KESFIVGADITEFLGLFAKPAQELDQWLQFANSIFNKLEDLPVPTLAALTGHALGGGCEC
VLATDFRIGDATTSIGLPETKLGIMPGFGGCVRLPRVIGADNAMEVITQGKACRAEEALK
IGLLDAIVDSDKLLESALKTITSAINETVDWKMRRQQKTSALTLSKLEAMMSFTMAKGLV
AQHAGPHYPAPITSVIAIEEAARCSRDEALAIERKHFVKLAHSEAAKSLVGLFLNDQYIK
ALAKKAAKSANKETGRAAVLGAGIMGGGIAYQSAVKGVPVLMKDIAQSSLNLGMTEASKL
LNKQLERGKIDGFKMASVLASITPSLHYAGIEQADVIVEAVVENPKIKAAVLSEVEANVG
EDAVITSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSLLLRDGADFTQIDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAQGFPERMGKQGRDAIDALFDANKYGQKNGSGFYQYTLDKKGK
PKKTFSEEVLTVLNVECGDKRTFDDQTIIERMMIPMINEVALCLEEKIIASPQEADMALV
YGLGFPPFRGGVFRYLDSLGLQNYVAMASQYQALGAMYHVPQLLLDMAEKGETFYGAQQA
SSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccaacaccctacaggtaaaggaattacaagatggtattgcggagttg
cgtttctgctccaaggagtcagtgaacaaacttgaccttgccactcttgaatcgctcaac
catgcacttgatgccctaaaagcccaccaaggactgaaaggccttattcttacttccgat
aaagaatcttttattgtcggggctgatatcactgagtttttaggcctctttgctaaacct
gcgcaagaactcgaccaatggctgcaatttgccaatagcattttcaacaaactagaagat
ctacccgttccgacactagccgctttaacagggcacgcgctaggcggtggatgtgagtgt
gtactcgctaccgatttccgtattggtgacgcgaccaccagcataggattaccggaaaca
aagcttggtattatgccggggttcggtggctgtgtgcgtctgcctcgtgtaattggtgcc
gacaatgctatggaagtgatcactcaaggcaaagcatgtcgtgctgaggaagcccttaaa
attgggctgctcgatgcgattgttgatagcgacaaactgcttgagtcagcactcaaaacc
atcacatcggccatcaatgaaaccgttgattggaaaatgcgtcgccagcaaaaaacgtcc
gcgctgacactcagcaaattagaagccatgatgagcttcaccatggccaaaggcttggtt
gcacagcatgccggacctcattatccagcgccaataacctctgttattgcaatagaagaa
gccgcgcgctgtagccgtgatgaagcattggccattgagcgtaaacacttcgttaagctc
gctcattctgaagcggcgaaatccttggtcggtttattcctcaacgaccaatatattaaa
gcactagcaaaaaaagcggctaaatcagccaataaagaaaccggacgagcggcggtactt
ggtgcggggatcatgggcggcggcattgcttatcaatcggcagtaaaaggcgtgcctgtt
ttgatgaaagatattgctcaatcgtcccttaatttaggtatgaccgaggcatctaagtta
ctcaacaagcagctagagcgcggaaaaattgatggttttaaaatggccagtgtgctggca
tcgattacgcctagcctgcattatgcggggattgagcaagcggatgtgattgttgaagct
gtggttgaaaacccgaaaatcaaagccgcggtactaagtgaagtcgaagccaatgttggt
gaggatgcggttatcacctcgaacacctcaaccattccaatcaacctactggccaaatca
ctcaaacgtccagaaaacttctgtggtatgcacttttttaacccagtacatcgtatgcca
ttggtggaaattattcgtggtgaacacacttccgatgaaaccatcaatcgagttgtcgct
tacgcggccaaaatgggtaaatcccccatagtggtcaatgactgccctgggttcttcgta
aaccgcgtacttttcccttactttggtggctttagtttattactgcgcgatggcgctgat
ttcactcaaatcgataaagtgatggaacgtaagtttggttggccaatgggccctgcttat
cttctagatgtggtcggtattgataccgctcaccatgcacaagcagtaatggcacaaggt
ttccccgaacgtatgggtaaacagggccgcgatgctattgatgcactgtttgacgccaat
aaatatggccagaaaaatggcagcggtttctatcaatacactttagataagaaaggcaaa
ccgaagaaaactttctctgaagaggtcctcactgttcttaacgtagaatgtggtgataaa
cgtacttttgatgatcaaactatcattgagcgcatgatgattccgatgatcaatgaagtg
gcactctgtttagaagagaagatcatcgcctcaccccaagaagcggatatggcgttggtg
tacggcttggggttccctccttttagaggcggcgtattccgctatctcgatagtcttggt
ttacaaaactacgttgcaatggcaagccaataccaagcattgggcgcgatgtatcatgta
cctcaactgctgcttgatatggcagaaaaaggcgagaccttctacggtgctcaacaagca
agttctatctaa

DBGET integrated database retrieval system