KEGG   Vibrio anguillarum M3: N175_02835Help
Entry
N175_02835        CDS       T02823                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
lag  Vibrio anguillarum M3
Pathway
lag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lag01100  Metabolic pathways
lag01110  Biosynthesis of secondary metabolites
lag01130  Biosynthesis of antibiotics
lag01230  Biosynthesis of amino acids
Module
lag_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    N175_02835 (aroK)
Enzymes [BR:lag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     N175_02835 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin Cytidylate_kin2 APS_kinase dNK AAA_17 AAA_16 ABC_tran TsaE AAA_22 AAA AAA_25 Ploopntkinase3 ATPase_2 AAA_5 RNA_helicase AAA_7 AAA_PrkA AAA_24 CoaE AAA_28 His_biosynth AAA_29 RsgA_GTPase IstB_IS21 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: AGU56753
LinkDB All DBs
Position
1:591648..592169
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLAQQLHMEFLDSDTVIEERTGADIAWVFDVEGEEGFR
KREEAVINDLTEKQGIVLATGGGSVKSKENRNRLSARGIVVYLETTIEKQLARTNRDKKR
PLLQTDNPREVLECLADERNDLYAEIADFTVRTDDQGAKVVANEIVKMLEEHS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgcaatattttccttgttggcccaatgggcgccggcaaaagtacaatt
ggtagacatcttgctcaacaactgcatatggagtttttagactcagatacagtcattgaa
gagcgtacaggcgcagatatcgcatgggtatttgacgtcgaaggtgaagagggcttccgt
aaacgtgaggaagctgtaattaatgacctaaccgagaaacaaggtattgtactcgcaaca
ggcggtggttctgttaagagtaaagaaaaccgtaatcgtttatctgctcgtggtattgtg
gtctaccttgaaacgacgattgaaaaacaacttgcacgcacgaaccgtgacaaaaaacgg
ccattgcttcaaacagacaatccacgtgaagtcttagaatgcttggctgatgaacgtaac
gatctttacgctgagatcgctgattttacggttcgtactgacgatcaaggtgcaaaagtg
gtagccaacgagatcgtaaaaatgctagaagaacattcctaa

DBGET integrated database retrieval system