KEGG   Vibrio anguillarum M3: N175_09620Help
Entry
N175_09620        CDS       T02823                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lag  Vibrio anguillarum M3
Pathway
lag00250  Alanine, aspartate and glutamate metabolism
lag00410  beta-Alanine metabolism
lag00430  Taurine and hypotaurine metabolism
lag00650  Butanoate metabolism
lag01100  Metabolic pathways
lag01110  Biosynthesis of secondary metabolites
lag01120  Microbial metabolism in diverse environments
lag02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    N175_09620
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N175_09620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    N175_09620
   00430 Taurine and hypotaurine metabolism
    N175_09620
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    N175_09620
Enzymes [BR:lag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     N175_09620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: AGU57927
LinkDB All DBs
Position
1:2040837..2042480
Genome map
AA seq 547 aa AA seqDB search
MVSEQKTANVSFESLLRIFTVPEGPDSTLTKIDQELSRNLNLFLREHIVAEEKPLKEIEK
DFSNPQIPESPEFVSEHTQHLLDNLVAHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYQKNDAFYSQWMHSANHSLGAFCSGGTIANITA
LWVARNNALKADGDFQGVEKEGLFKAMRHYGYHGLAILVSDRGHYSLKKAADVLGIGQEG
LVCVKTDHNNRLCPQDLKAKMAHLKSQKIKSFAVVGVAGTTETGNIDPLRDIANICQQEG
CHFHVDAAWGGATLMSNNHRHLLNGIELADSVTIDAHKQLYIPMGAGMVLFKKPDAMHSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYELLIDQSLAKARYFADL
IKEQDDFELISEPELCLLTYRYIPAFVRQALQQALPNQKAELNELLNEITQFVQKKQRET
GRSFVSRTRLNPERWDKLDTIVFRVVLANPLTTHAILHSILDEQRHIATLAPNLMAKIEL
LAQRIIS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaacaaaaaactgcaaatgtgagtttcgagagcttgttacggatcttcact
gtgcccgaaggccccgactcaacactgacaaaaatagaccaagagctatcgcgcaatttg
aacctcttcttgcgtgaacatattgtcgctgaagaaaaaccactcaaagagatcgaaaaa
gatttctctaatccgcaaattccagagtcaccggagttcgtttcagaacatactcagcat
ttgttggataatttagtcgctcattcagtgcatacctcggctcctagctttattggtcat
atgacatctgcactgccatatttcttgatgccgttatcaaagatcatgattgcgctgaat
caaaacttagtcaaaattgaaacgtcaaaagcgtttacaccgctagaacggcaggttttg
ggtatgttgcatcgtttgatctatcaaaaaaacgacgctttttacagccaatggatgcat
agcgctaatcattcgctcggtgcattttgctctggcggaacaattgccaatatcacggca
ttgtgggtggctcgtaataatgctttgaaagccgatggtgatttccaaggcgtcgaaaaa
gaggggctgtttaaagccatgcgtcattatggttaccacgggttagccattttagtgtct
gatcgtggccattactctttaaagaaagccgctgacgtattgggtatcggccaagaaggc
ttggtttgtgtaaaaaccgaccacaacaaccgcttatgcccacaagatttgaaagccaaa
atggcacacctaaaaagccagaaaattaaatcttttgcggttgttggcgtcgccggaacg
acagaaacgggcaacattgatcccttaagagatatcgccaatatttgccagcaagaaggt
tgtcattttcacgtagacgccgcttggggcggtgcaacattaatgtcgaataatcaccga
cacttactcaatggtattgagttggctgactccgtcacgattgatgcacataaacagctc
tacatccctatgggtgcaggcatggtactattcaaaaagcctgatgctatgcattcaatt
gagcaccatgcgcagtatattttgcggaaaggttcaaaagatctaggcagccatacgtta
gaaggttctcgttcaggtatggccatgttggtgtacgctagcatgcacattattagtcgc
cctggctacgaattattgattgaccaaagcctagctaaagctcgctatttcgccgatcta
attaaagaacaagacgattttgaactgatttctgaacccgaactgtgtcttttaacctat
cgttatattcctgcttttgttcgccaagcactgcaacaagccttgcctaatcaaaaagca
gaactgaacgagttgctaaatgaaatcacccagtttgtgcagaaaaaacaaagggaaacg
gggcgttcatttgtctctcgaactcgtttaaacccagaacgctgggacaagcttgatacc
attgtatttcgcgtggtactagccaacccgctaacaacacatgctatcttgcactcgatc
ttagatgagcagcgacatattgccacgctagcccctaatttgatggccaaaattgagcta
cttgctcaaagaatcatcagctag

DBGET integrated database retrieval system