KEGG   Labrenzia aggregata: B0E33_06275Help
Entry
B0E33_06275       CDS       T04723                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lagg  Labrenzia aggregata
Pathway
lagg00480  Glutathione metabolism
lagg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lagg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B0E33_06275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lagg02000]
    B0E33_06275
Enzymes [BR:lagg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     B0E33_06275
Transporters [BR:lagg02000]
 Other transporters
  Pores ion channels [TC:1]
   B0E33_06275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_N_4 Tom37 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AQQ03253
LinkDB All DBs
Position
1340318..1341040
Genome map
AA seq 240 aa AA seqDB search
MKRSFQMPDTLTLISHALCPYVQRAAIVLHEKNVPFDRVTIDLADKPDWFRAASPLGKVP
LLKLGADRYLFESAPIVEFLDETEGSRLHPEDPSERARHRAYIEFASQILNGIGALYNAR
DDTGFYAAGEALRAKFRHLESELDPDGPFFAGSAFSLVDAAFAPVFRYFDVFESFLTLEM
FDDLDRVLAWRSKLAARTSVQEAVTADYPALLTAFLQNRNSWISQLLDLRSRERSLLVAH
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggagtttccagatgcccgacacactcaccctgatcagccatgcgctttgccct
tacgtgcagcgcgcggcgatcgtccttcatgaaaagaatgttccgtttgaccgggttacc
atcgaccttgccgacaaacctgactggttccgcgcggcctcaccactcggcaaggtgccg
ctgctgaaactgggtgctgatcgctatctcttcgaatccgccccgatcgtcgaattcctg
gacgagacagaagggagccggctgcacccggaggacccttccgaacgcgcgcggcaccgg
gcctatatcgaatttgcctcgcagatcctgaacggtatcggcgcgctctacaacgccagg
gacgacaccgggttttatgctgcgggtgaagcacttcgtgcaaagttccgtcatctggaa
agcgaacttgatccggacggtcccttcttcgccggtagtgccttttcgctcgtcgatgcg
gctttcgccccggtgttccgatatttcgatgtctttgagtcgttcttgacgcttgaaatg
tttgacgacctcgaccgggttcttgcgtggcgtagcaagcttgcggcccgtacatcggtt
caagaagcagttactgcggactatccagcgctattgaccgcctttctgcaaaatcgaaat
agctggatctcccaacttctcgacttgcgcagccgggagcgatcactcctggtcgcacac
tga

DBGET integrated database retrieval system