KEGG   Labrenzia aggregata: B0E33_11605Help
Entry
B0E33_11605       CDS       T04723                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
lagg  Labrenzia aggregata
Pathway
lagg00220  Arginine biosynthesis
lagg01100  Metabolic pathways
lagg01110  Biosynthesis of secondary metabolites
lagg01130  Biosynthesis of antibiotics
lagg01210  2-Oxocarboxylic acid metabolism
lagg01230  Biosynthesis of amino acids
Module
lagg_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:lagg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    B0E33_11605
Enzymes [BR:lagg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     B0E33_11605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AQQ07319
LinkDB All DBs
Position
2486645..2487787
Genome map
AA seq 380 aa AA seqDB search
MLEKLISFNTVSDRSNLDLITFVEDYLSQWGVTSGRALDETGQKAALYARIGPDIDGGTV
LSAHTDVVPVAGQNWSHDPFSAWEENGRLYGRGAADMKGFAATVLAKVPDFLNAPLRRPI
HIALSYDEETGCDGARVLIPEMLANGPRPSVVIVGEPTSMKVVTGHKGITVLKTRIQGHP
VHSSQLHRGVSAISVAARLIGWLDARTAENRAKADPDCPFEPPYTTLHCGTISGGQAHNI
TAQHCEFVTDIRLLPGEHAKDWVAAYRAFIENEVLPGMKAISPDCAIEVRELAYVPGLGE
EPDGLAETTARRLTGDNSRNVVVYATEGGIFQDHGLSTVVCGPGSIDQAHQPDEFIELSE
LDRCAAFLDKLIDRMSQFDS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaaactgatctccttcaacaccgtttcggatcgaagcaacctcgatctgatc
accttcgtcgaagactatctcagccaatggggtgtcacttcagggcgggcgctggatgaa
acgggccaaaaggccgctctttatgcccgcatcggtccggatatcgacggcggaaccgtc
ctgtccgcccacaccgatgtcgttccggtggcgggccagaactggtctcacgatcctttt
tccgcctgggaggaaaacggccgcctctacggccgtggcgcggcggacatgaaaggcttc
gcggcaactgtacttgccaaggttccggattttctgaatgcaccgctcagacggcccatc
cacatcgcgctgtcctatgacgaggaaaccggctgcgacggggccagggtgctgatccct
gaaatgctggcaaacggcccgcgcccttccgtggtgattgtgggcgaaccgaccagcatg
aaggtcgttacgggccacaagggcattacagtactgaagacgcgcatccagggacatccg
gtccattccagccagttgcaccggggtgtttcggcgatttcggtggcggccaggctgatc
ggctggctggatgccagaaccgcggagaaccgggccaaggccgatcctgactgcccgttc
gaaccgccctacaccaccttgcattgcggcaccatttccggcggccaggcgcacaacatc
acggcccagcactgcgaattcgtgaccgatatccggctgctgccgggtgaacacgcgaag
gactgggtcgcagcctaccgggccttcatcgaaaatgaggttctgccgggaatgaaagcg
atctcgccggactgcgccatcgaggtgagagaacttgcctatgtgcccgggctgggagag
gaaccggacgggctggcggaaaccactgccaggcgcctgaccggcgacaacagccgcaac
gtcgtggtctatgccaccgaaggcgggatcttccaggatcacggactttcgaccgtggtt
tgcggtcccggatccatcgatcaggcccatcagcccgacgaatttatcgagctttccgaa
ctcgaccgctgcgctgccttcctcgacaagctgattgacagaatgtcgcaatttgacagc
taa

DBGET integrated database retrieval system