KEGG   Labrenzia aggregata: B0E33_12270Help
Entry
B0E33_12270       CDS       T04723                                 

Definition
(GenBank) beta-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
lagg  Labrenzia aggregata
Pathway
lagg00061  Fatty acid biosynthesis
lagg01100  Metabolic pathways
lagg01212  Fatty acid metabolism
Module
lagg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lagg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B0E33_12270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lagg01004]
    B0E33_12270
Enzymes [BR:lagg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     B0E33_12270
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     B0E33_12270
Lipid biosynthesis proteins [BR:lagg01004]
 Fatty acid synthase
  Component type
   B0E33_12270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AQQ04267
UniProt: A0A0M6Y8Q1
LinkDB All DBs
Position
2628334..2628840
Genome map
AA seq 168 aa AA seqDB search
MTDRRSSYDYEALLACGRGELFGPGNAQLPLPPMLMFDRITELSETGGEFDKGFARAEFD
IKPDLWFFPCHFQGNPVMPGCLGLDALWQLTGFFLGWLGLEGKGMALSTGEVKFKGMVTP
DVKLVEYGVDFKRVMKGRLVLGIADGWLKADGEQIYKATDLRVGLAKT
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgccgctccagctacgattatgaagcacttctcgcctgcggccgcggcgag
ctgtttggcccgggcaatgcccagctgcctcttcccccgatgctgatgttcgaccggatc
acggaactttccgaaaccggcggtgaattcgacaaggggttcgctcgcgccgagttcgac
atcaagccggatctctggtttttcccgtgccatttccagggaaatccggtgatgccgggc
tgccttggtctcgacgccctgtggcagctgaccggtttcttccttggctggctgggcctt
gaaggcaagggcatggccctgtcgaccggtgaagtgaagttcaagggcatggttacgccg
gacgtgaagctggtggaatacggtgtcgacttcaagcgggtcatgaagggtcgcctggtt
ctcggcattgccgacggctggttgaaggcggacggtgaacagatttacaaggcgaccgat
ttgcgcgtcggcctggcaaagacctga

DBGET integrated database retrieval system