KEGG   Labrenzia aggregata: B0E33_20265Help
Entry
B0E33_20265       CDS       T04723                                 

Definition
(GenBank) dimethlysulfonioproprionate lyase DddL
  KO
K16953  dimethylpropiothetin dethiomethylase [EC:4.4.1.3]
Organism
lagg  Labrenzia aggregata
Pathway
lagg00920  Sulfur metabolism
lagg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lagg00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    B0E33_20265
Enzymes [BR:lagg01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.3  dimethylpropiothetin dethiomethylase
     B0E33_20265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7 Cupin_2 DUF3155
Motif
Other DBs
NCBI-ProteinID: AQQ05616
LinkDB All DBs
Position
complement(4383107..4383781)
Genome map
AA seq 224 aa AA seqDB search
MSEEQPLASRRLAEFPDWGYLLREFYEAYRFLSSGGSDKIRAHQRAVREAIGRVLKSDPE
MRFDAPAHKPVTAHLRRALDEGKQERTAPLVRAIESVRDHLIWQYGYEKVPRGLDKTYAY
AEICGPNGPVLTTDVILGLVLFAPGCTYPAHAHSGISESYICVSGSVSENHQGVYAPGSM
IFNPPEHMHRITVSKLEPALLAWAWIGPPERLANQKMVFSRKKG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagaacagcctctggccagccgccgcctcgccgagttcccggactggggctat
cttttgcgggaattctacgaggcctaccggttcctctcgtccggtggcagcgacaagatt
cgggctcatcagcgcgcggtgcgcgaggcaattgggcgggtgctgaaatccgatccggaa
atgcgtttcgatgccccggcccacaaacccgtgaccgcacatctccggcgtgcccttgac
gagggcaagcaggagcggaccgctccgctggtgcgtgccatcgaaagtgtccgggaccat
ctcatctggcagtatggctacgagaaggtgccgcgcggcctcgacaagacgtatgcctac
gcggaaatctgcggaccgaacggaccggttctgacgacggacgtcattctgggcctggtc
ctgttcgcaccgggctgcacctatccggcccacgcgcacagcggcatatcggaaagctat
atctgcgtttcaggatcggtttcggaaaatcaccagggggtctatgcgcccgggtcgatg
atcttcaacccgccggagcatatgcaccggatcaccgtgtccaaactggagccggcactt
ctggcctgggcctggatcggcccgccggaacgcctcgccaaccagaagatggtcttcagc
cgcaagaaggggtga

DBGET integrated database retrieval system