KEGG   Labrenzia aggregata: B0E33_25140Help
Entry
B0E33_25140       CDS       T04723                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lagg  Labrenzia aggregata
Pathway
lagg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lagg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B0E33_25140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lagg02000]
    B0E33_25140
Enzymes [BR:lagg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     B0E33_25140
Transporters [BR:lagg02000]
 Other Transporters
  Pores ion channels [TC:1]
   B0E33_25140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AQQ06460
LinkDB All DBs
Position
5384002..5384652
Genome map
AA seq 216 aa AA seqDB search
MADQVELFYAPQTRATGVRVLLEELGAPYKLNVLNLKLGENRTPRYLAVNPAGKVPALRV
GEAVITEQVAIYIYLADLFPEKGLTPSLDDPLRGPYLRWFVHMASCFEPALIDRALKREE
PPHSMSAYGSFDTVMESMRAQLAKGPFVLGERMTAVDVLWGMGLRWGTMFGIVPEFEEFT
AYIERFAERPSVVKVLQEDQNMAREQEDAAVQAGVA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcaggtcgaactcttttatgcacctcagacacgcgccaccggcgtacgtgtt
ctcctggaggagctgggcgcaccttacaagctgaatgtgctcaatctgaagttgggtgaa
aaccggaccccccgatatcttgccgtcaacccggctggcaaagttccggcattgcgcgtt
ggcgaggcagtcattaccgaacaggtcgcgatctatatctatctggccgacctgtttccc
gaaaaaggactgacaccctcgctggatgatccactgcgtggaccgtacctgcgatggttc
gtgcatatggcatcctgttttgagccggcactgatcgaccgcgcactcaagcgtgaagaa
ccgccgcattccatgtccgcctatggttcttttgacaccgtcatggaaagcatgcgtgcc
cagctggcaaagggacccttcgtccttggagaacgcatgacggctgtcgacgttctgtgg
ggcatggggctgcggtggggaacaatgttcggcatcgtaccggaattcgaagaattcacc
gcctacatcgagcggttcgccgaaaggccgtcggtggtcaaggtactgcaggaagaccag
aacatggccagggagcaggaagacgctgctgttcaggcgggcgtcgcgtaa

DBGET integrated database retrieval system