KEGG   Lactobacillus agilis: BEN83_06340Help
Entry
BEN83_06340       CDS       T05198                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
lagl  Lactobacillus agilis
Pathway
lagl00061  Fatty acid biosynthesis
lagl00620  Pyruvate metabolism
lagl00640  Propanoate metabolism
lagl01100  Metabolic pathways
lagl01110  Biosynthesis of secondary metabolites
lagl01120  Microbial metabolism in diverse environments
lagl01130  Biosynthesis of antibiotics
lagl01200  Carbon metabolism
lagl01212  Fatty acid metabolism
Module
lagl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lagl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BEN83_06340
   00640 Propanoate metabolism
    BEN83_06340
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BEN83_06340
Enzymes [BR:lagl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BEN83_06340
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BEN83_06340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATPgrasp_Ter GARS_A ATP-grasp_3 DUF3182 ATP-grasp_4 ATPgrasp_ST ATPgrasp_YheCD PRANC
Motif
Other DBs
NCBI-ProteinID: ASR41113
UniProt: A0A222W537
LinkDB All DBs
Position
complement(1227118..1228497)
Genome map
AA seq 459 aa AA seqDB search
MFSKVLVANRGEIAVRIIRSLKELGIKSVAIYSTADRESLHVQLADEAVCVGTARPQDSY
LNMQNILAAAVGTGAEAIHPGFGFLSENSRFVEMCEACGLTFIGPKSQTIELMGNKANAR
MQMQASNVPVIPGSDGFISDVTEAKAVAKKVGYPVLLKAAAGGGGKGIRRVNDEDELTTA
FEEARREAQNGFGDNRMYLEKIMENVKHIEVQIFRDQAGHTVYFPERDCSVQRSKQKMIE
ESPCSVITPAQRKELGQIAVRAANAIDYLNTGTIEFLMDSEHHFYFMEMNTRIQVEHTVT
EMVTGIDLVKAQVKVASGEDLPFKQADIKANGYAIECRINAEDPAKNFMPSVGKVKYLYF
PVGNLGMRIDSDLYSGLVIPPYYDSMIAKVIALGHDRHEAIEKVKRLLNEMVILGITTNQ
AIHLDILQAPTFLKDQVTTDYLEREFLPKWKEGLDSATV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaaaagttttagttgctaaccgcggggaaatagcggttcggatcatccgttct
ttaaaagaattaggtatcaagtcagttgctatctattcgacggccgaccgtgaaagcttg
cacgttcagttggcagatgaagcggtctgtgttgggacggcccgaccacaggattcatat
ttaaatatgcaaaatatcctggctgcagctgttggaactggggcagaagcaatccatccc
ggttttggcttcttgtctgaaaacagccgctttgtggaaatgtgtgaagcttgtggcttg
acctttatcgggcctaagtcacaaaccattgaattaatggggaataaggccaacgcccgg
atgcaaatgcaggcaagtaacgttccggttatccccggtagtgacggctttatctcagat
gtaactgaggctaaggcagtggctaaaaaagttggctacccggtgttgttaaaagctgct
gccggtggtggcggtaaggggattagacgtgttaacgatgaagatgagttaacgacggcc
tttgaagaggcacgccgggaggctcaaaacggttttggtgataaccggatgtacttggaa
aaaatcatggaaaatgttaaacacattgaggtgcagattttccgtgaccaggccggccat
acggtatatttcccagaacgggattgttccgttcaaagaagtaagcaaaagatgattgaa
gaaagtccctgctcggtaattacgcccgcgcaaagaaaagaactcggccaaattgccgtg
cgggctgctaacgcgattgattacctaaatacagggaccatcgaatttttaatggatagc
gagcatcatttctatttcatggaaatgaatacccgcattcaagttgaacatacggtaaca
gaaatggttacgggaattgatttggttaaagcccaggtgaaggtggcctctggtgaggat
ttacctttcaagcaagcagatatcaaggcgaatggctatgcaatcgaatgtcggattaat
gctgaagatccggccaaaaattttatgccctctgtcggtaaggtcaagtacctctacttc
cccgttggcaacctagggatgcggattgactctgacttgtactcagggctagtaattccg
ccttactatgactcaatgattgccaaggtgattgctttaggccacgaccggcacgaggca
atcgaaaaggttaagcgccttttaaacgagatggtaattttagggattacgaccaaccaa
gccattcacctagacatactccaagcaccaactttcttaaaagaccaggtaacaaccgat
tatctggagagagagtttttgcctaagtggaaggaagggttagatagtgcaactgtttga

DBGET integrated database retrieval system