KEGG   Lactobacillus amylophilus: LA20533_03435Help
Entry
LA20533_03435     CDS       T05031                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lah  Lactobacillus amylophilus
Pathway
lah00473  D-Alanine metabolism
lah00550  Peptidoglycan biosynthesis
lah01100  Metabolic pathways
lah01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LA20533_03435
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LA20533_03435
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LA20533_03435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lah01011]
    LA20533_03435
Enzymes [BR:lah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LA20533_03435
Peptidoglycan biosynthesis and degradation proteins [BR:lah01011]
 Precursor biosynthesis
  Amino acid ligase
   LA20533_03435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 TTL ATP-grasp_4 Fur_reg_FbpA
Motif
Other DBs
NCBI-ProteinID: APT18379
UniProt: A0A0R1YTD8
LinkDB All DBs
Position
complement(635288..636370)
Genome map
AA seq 360 aa AA seqDB search
MMEKIKVGLVFGGESSEFEVSVNSAQNIYHAIDQAKYEVYPLGFTQDGYLASPSESSKLL
EDASYQVVRGETVPNLNHLIELQNYPALDIFLPIIHGNIGEDGAIQGLFRVLGVPFVGSD
VLGAAATMDKDLSKILAERIGLKVAKWLTIKRPQYEDQIAEFVDYEQVAAKLGRKVFVKP
ANQGSSVGIAPAQDATEYAAALADAFRYDDKVLVEEAINAIEVETAVLGNDRPIVSGVGQ
IINAADEFYTYENKYEENSTSTLQIPAAIPAETASQIRAQALAIYQKIEVFGLARVDFMI
KRETGEIIFNEINAIPGFTNISMYPKLFEQAGIHYPELIDQLIQFGLERYRHLQELSHHI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgatggagaaaatcaaagttggtctagttttcggtggcgaatcctcggaattcgaggtt
tcagtgaactctgcccagaatatttaccacgcaattgatcaagctaaatatgaggtttac
ccactcggattcacgcaagatggttacctagcgagtccaagtgagtctagtaagctattg
gaagatgccagttatcaggtggtgagaggcgagactgtacccaaccttaatcatctgatt
gagctacaaaactatcctgcactggatatttttctgccaatcattcacggaaatatcggt
gaagacggtgccattcagggcttattccgggtgcttggcgtgccgttcgttgggtccgac
gtcctcggagccgcggcaacaatggataaggatttatccaaaattctggctgagaggatt
ggcctcaaggtggccaagtggctaaccatcaaacgaccacagtacgaggatcagattgcc
gagttcgttgactacgaacaggtggcggctaaactcggccgcaaggtcttcgtgaagccg
gctaatcagggttcctctgtgggcatcgcaccggcccaggatgccacagagtatgctgcc
gcactagcggatgccttcaggtatgacgacaaggtgctcgtcgaggaagccattaatgcg
attgaggtcgagacggccgtgctggggaacgaccggccaatcgtgagcggtgtggggcag
ataatcaatgccgccgacgagttctacacatacgagaataagtacgaggagaattctacc
tcgactttgcaaatcccggcggcgattccggcagagacagctagccagattcgtgcacag
gcgcttgccatctaccaaaagattgaggtgtttggcctagcccgtgtagactttatgatt
aagcgggaaacgggtgagatcattttcaatgagatcaatgcaattcctggattcacgaat
atcagcatgtacccgaaattgtttgagcaggcgggcattcattatccggagctcattgac
cagctgattcaatttggcctggagcggtatcgccacctgcaggagttgagtcaccacatc
taa

DBGET integrated database retrieval system